Recombinant Ochrobactrum anthropi Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Biological Role

Glycerol-3-phosphate acyltransferase (PlsY) belongs to the acyltransferase family (EC 2.3.1.n3) and is essential for membrane lipid assembly in bacteria . In O. anthropi, PlsY specifically transfers acyl groups from acyl-phosphate to the sn-1 position of G3P, forming 1-acyl-G3P . This reaction is a key regulatory node in phospholipid metabolism, influencing membrane fluidity, permeability, and virulence-related adaptations observed in the Brucellaceae family .

Genetic and Protein Characteristics

The plsY gene in O. anthropi (strain ATCC 49188) is encoded by locus Oant_3668 and produces a 201-amino acid protein (UniProt ID: A6X570) . Key structural and functional features include:

PropertyDetail
Catalytic ActivityAcyl-CoA + sn-glycerol 3-phosphate → CoA + 1-acyl-sn-glycerol 3-phosphate
Active Site MotifsConserved residues for acyl-phosphate binding and G3P recognition
Post-Translational ModificationsNone reported; functions as a monomeric membrane-associated enzyme

The recombinant protein retains these properties when expressed in heterologous systems like E. coli .

Recombinant Expression and Purification

Recombinant PlsY is typically produced with an N-terminal His-tag for affinity purification . Key production parameters include:

Table 1. Recombinant PlsY Production Details

ParameterSpecification
Expression SystemEscherichia coli BL21(DE3) or similar strains
TagN-terminal His-tag (confirmed via SDS-PAGE and Western blot)
Storage BufferTris-based buffer (pH 7.4–8.0), 50% glycerol, protease inhibitors
Purity>90% (assessed by HPLC and mass spectrometry)
StabilityStable at -80°C for >12 months; avoid freeze-thaw cycles

The full-length recombinant protein includes residues 1–201, with a molecular weight of ~23 kDa .

Functional Insights from Comparative Studies

PlsY homologs in Brucella spp. and O. anthropi share structural similarities but differ in regulatory mechanisms:

  • Membrane Permeability: Unlike Brucella, O. anthropi membranes are less permeable to hydrophobic molecules, partly due to differences in lipid A and phospholipid composition .

  • Virulence Linkage: Overexpression of Brucella lipid biosynthesis genes (e.g., cgs) in O. anthropi enhances survival in macrophage models, suggesting PlsY’s role in pathogenicity .

Table 2. Comparative Lipid A Features in Brucella vs. O. anthropi

FeatureBrucella abortusO. anthropi
Lipid A VLCFAPresent (C28–C30) Present (C26–C28)
TLR4 ActivationWeak (low endotoxicity) Moderate
Cationic Peptide ResistanceHigh Low

Applications in Research

Recombinant PlsY is utilized to:

  1. Study lipid metabolism in Brucellaceae and related pathogens .

  2. Engineer bacterial strains with altered membrane properties for industrial or therapeutic purposes .

  3. Develop inhibitors targeting glycerolipid biosynthesis in multidrug-resistant bacteria .

Future Directions

Unresolved questions include:

  • Structural determination of PlsY’s membrane-binding domains.

  • Role of PlsY in O. anthropi’s adaptation to host environments during opportunistic infections .

  • Evolutionary divergence of GPAT enzymes in Alphaproteobacteria .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can fulfill specific format requests. Please indicate your preferred format when placing the order.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice shipment is required, please contact us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
plsY; Oant_3668; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / JCM 21032 / NBRC 15819 / NCTC 12168)
Target Names
plsY
Target Protein Sequence
MAEPGFLSLTLIGALVFGYFLGSIPFGLILTRLAGLGDVRSIGSGNIGATNVLRTGNKKL AAATLIFDMLKGTVAVLVASRYGPDAAIGAGFGAFIGHLFPVWIGFKGGKGVATYLGVLI GLAWPGALVFAAVWIVTALLTRYSSLAALIASIVVPIALYSRGYPAIAVLFAIMTVIVIF KHKANITRLLNGTESKIGAKG
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). While it utilizes acyl-phosphate as the fatty acyl donor, it does not utilize acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Ochrobactrum anthropi and why is it used as a model organism for recombinant protein expression?

Ochrobactrum anthropi is a gram-negative soil bacterium that is one of the closest phylogenetic relatives to Brucella species based on DNA, rRNA, and protein analyses. It is considered an opportunistic pathogen that, under certain circumstances, may produce disease in immunocompromised humans, but unlike Brucella, it is unable to establish chronic infection . Several characteristics make O. anthropi an excellent model for recombinant protein expression:

  • Genetic similarity to Brucella species (a significant pathogen) without the same level of pathogenicity

  • Ability to express foreign genes with proper folding and post-translational modifications

  • Established enhanced expression systems for heterologous genes

  • Relative ease of laboratory handling compared to more pathogenic relatives

Researchers have successfully used O. anthropi as a gain-of-function model for studying putative virulence genes of intracellular pathogens, particularly for Brucella, proving it to be a very useful expression system .

What is the role of Glycerol-3-phosphate acyltransferase (plsY) in bacterial metabolism?

Glycerol-3-phosphate acyltransferase (plsY) is a critical enzyme in bacterial phospholipid biosynthesis. It catalyzes the first committed step in the synthesis of membrane phospholipids by transferring an acyl group to the sn-1 position of glycerol-3-phosphate (G3P), forming lysophosphatidic acid (LPA). This reaction represents a crucial metabolic junction connecting fatty acid metabolism with phospholipid assembly.

The enzyme is particularly important in bacterial membrane formation, as phospholipids constitute the fundamental building blocks of cell membranes. In O. anthropi, as in other bacteria, plsY plays essential roles in:

  • Membrane phospholipid biosynthesis

  • Cell envelope integrity maintenance

  • Adaptation to environmental conditions through membrane modification

  • Potential virulence through altered membrane composition

What expression systems are most effective for producing recombinant proteins in Ochrobactrum anthropi?

Based on research with O. anthropi, several expression systems have proven effective for recombinant protein production. The selection of an appropriate expression system depends on research objectives and protein characteristics:

Expression SystemAdvantagesDisadvantagesBest Applications
pBBR1MCS-based vectorsMedium copy number, stable in absence of selectionModerate expression levelsLong-term expression studies
Broad-host-range vectorsFunction across multiple speciesVariable expression levelsComparative studies
Inducible promoter systemsControlled expression timingMay require specific inducersToxic protein expression
Constitutive promotersContinuous expressionCannot be regulatedStable protein production

Research has shown that enhanced expression systems developed specifically for Brucella can be effectively utilized in O. anthropi. For example, researchers have created tools to enhance expression, detection, and purification of Brucella recombinant proteins in Ochrobactrum . When selecting an expression system, researchers should consider the specific properties of plsY and experimental requirements.

What are the optimal conditions for expressing recombinant O. anthropi plsY in laboratory settings?

The expression of recombinant O. anthropi plsY requires careful optimization of multiple parameters to ensure maximum yield and activity. Based on related studies with recombinant proteins in O. anthropi, the following conditions have proven effective:

Culture Conditions:

  • Temperature: 25-30°C (lower temperatures often improve protein solubility)

  • Medium: Typically LB or specialized minimal media supplemented with appropriate carbon sources

  • Growth phase: Mid-log phase typically yields optimal expression

  • Induction time: 4-6 hours for inducible systems

Expression Enhancements:

  • Codon optimization may be necessary for heterologous expression

  • Addition of chaperone proteins can improve folding

  • The presence of specific cofactors or substrates may stabilize the enzyme

In related research, PytY protein from O. anthropi YZ-1 was easily expressed as a soluble recombinant protein, which facilitated its purification and biochemical characterization . Similar approaches may be applicable to plsY expression.

How can researchers effectively purify recombinant plsY from O. anthropi expression systems?

Purification of recombinant plsY from O. anthropi requires a strategic approach due to its membrane-associated nature. The following methodology has proven effective for similar membrane-associated enzymes:

  • Membrane Fraction Isolation:

    • Cell lysis via sonication or French press

    • Differential centrifugation to separate membrane fractions

    • Detergent solubilization (typically using mild detergents like n-dodecyl-β-D-maltoside)

  • Purification Strategy:

    Purification StepMethodExpected RecoveryPurity Level
    Initial CaptureImmobilized metal affinity chromatography (IMAC)70-80%Moderate
    IntermediateIon exchange chromatography60-70%High
    PolishingSize exclusion chromatography50-60%Very high
  • Critical Considerations:

    • Maintaining enzyme stability throughout purification (temperature, pH, protease inhibitors)

    • Preserving the native conformation and activity

    • Determining appropriate detergent concentrations to maintain solubility without denaturing

Tools for enhancement of heterologous gene expression and protein purification have been created and demonstrated to work in Ochrobactrum, which could be applied to plsY purification strategies .

What assays are most reliable for measuring plsY enzymatic activity after recombinant expression?

Accurate assessment of plsY enzymatic activity is crucial for characterizing the recombinant enzyme. Several complementary approaches can be employed:

Radiometric Assays:

  • Utilizing 14C or 3H-labeled acyl donors

  • Measuring incorporation into lysophosphatidic acid

  • Quantification via scintillation counting

Spectrophotometric Assays:

  • Coupling plsY activity to reactions that produce chromogenic products

  • Monitoring acyl-CoA or acyl-ACP depletion

  • Following pH changes associated with the reaction

HPLC/MS-Based Methods:

  • Direct quantification of reaction products

  • Identification of lysophosphatidic acid formation

  • Analysis of substrate specificity with various acyl donors

Assay TypeSensitivityAdvantagesLimitations
RadiometricVery highDirect measurement of product formationRequires radioactive materials
SpectrophotometricModerateReal-time monitoring, no radioisotopesPotentially less specific
HPLC/MSHighPrecise product identificationExpensive equipment, not real-time

When developing activity assays, researchers should consider factors like substrate availability, enzyme stability, and the potential presence of interfering substances from the expression system.

How does recombinant O. anthropi plsY compare structurally and functionally to homologous enzymes from related bacteria?

Comparative analysis of O. anthropi plsY with homologous enzymes provides valuable insights into evolutionary relationships and functional conservation. While specific data on O. anthropi plsY is limited in the provided search results, general patterns in bacterial acyltransferases suggest:

Structural Comparison:

  • plsY enzymes typically feature 7-9 transmembrane domains

  • A conserved catalytic triad (His/Asp/Ser) in the active site

  • Variable substrate-binding regions that determine acyl chain specificity

Functional Analysis:

OrganismSequence IdentitySubstrate PreferenceCatalytic Efficiency
O. anthropi100% (reference)Moderate to long-chain acyl groupsBaseline
Brucella spp.~85-90% (estimated)Similar to O. anthropiPotentially higher
E. coli~40-60% (estimated)C16-C18 acyl groupsVariable

Research on related bacteria indicates that despite sequence variations, functional conservation is typically high across species, with substrate specificity being more variable than catalytic mechanism. Phylogenetic analysis of related enzymes, such as the pyrethroid-degrading esterase from O. anthropi YZ-1, has provided insights into enzyme family relationships , and similar approaches could be applied to plsY.

What role might plsY play in O. anthropi survival and adaptation in different environmental conditions?

The plsY enzyme likely contributes significantly to O. anthropi's environmental adaptability through its central role in membrane lipid composition. Evidence from related research suggests several potential adaptation mechanisms:

  • Temperature Adaptation: Modulation of membrane fluidity through altered acyl chain incorporation

  • pH Tolerance: Modifications to membrane phospholipid headgroups affecting proton permeability

  • Osmotic Stress Response: Changes in membrane composition affecting cell integrity

  • Nutrient Limitation: Efficient utilization of available fatty acids for membrane synthesis

As a soil bacterium that can occasionally act as an opportunistic pathogen, O. anthropi must adapt to diverse environments. The enzymatic flexibility of plsY likely contributes to this adaptability, similar to how other enzymes in O. anthropi contribute to its survival in various conditions. For example, O. anthropi possesses enzymes responsible for xenobiotic compound degradation , which contribute to its environmental versatility.

What are the implications of plsY structure-function relationships for the development of antimicrobial compounds targeting phospholipid biosynthesis?

The essential nature of plsY in bacterial phospholipid biosynthesis makes it a potential target for antimicrobial development. Structure-function studies of recombinant O. anthropi plsY could reveal:

  • Critical Catalytic Residues: Identification of amino acids essential for substrate binding and catalysis

  • Conformational Changes: Understanding enzyme dynamics during catalysis

  • Species-Specific Features: Structural differences between bacterial and eukaryotic acyltransferases

These insights could guide rational drug design approaches targeting bacterial membrane synthesis. Potential therapeutic implications include:

Target FeatureAntimicrobial StrategyAdvantageChallenge
Active siteCompetitive inhibitorsDirect inhibition of catalysisPotential cross-reactivity
Allosteric sitesNon-competitive inhibitorsModulation of enzyme activityIdentification of suitable sites
Protein-protein interactionsDisruption of multienzyme complexesNovel mechanism of actionComplex interaction networks

The study of O. anthropi plsY could be particularly valuable due to its relationship to Brucella species, which are significant pathogens. Research has shown that understanding the biochemical pathways in O. anthropi can provide insights into pathogenic mechanisms in related bacteria .

What are common pitfalls in expressing functional recombinant O. anthropi plsY and how can they be addressed?

Researchers working with recombinant plsY from O. anthropi may encounter several challenges. Based on experiences with similar membrane proteins and recombinant expression in Ochrobactrum, the following issues and solutions have been identified:

Common Challenges:

  • Protein Insolubility:

    • Problem: Formation of inclusion bodies due to membrane protein overexpression

    • Solution: Lower induction temperature (16-25°C), reduced inducer concentration, co-expression with chaperones

  • Low Expression Yields:

    • Problem: Insufficient protein production for downstream analyses

    • Solution: Codon optimization, use of stronger promoters, optimization of growth media

  • Loss of Enzymatic Activity:

    • Problem: Expression of correctly folded but inactive enzyme

    • Solution: Addition of specific lipids or substrates during expression, careful selection of detergents

Researchers have successfully addressed similar issues with other recombinant proteins in O. anthropi. For instance, in the study of PytY protein from O. anthropi YZ-1, the induced recombinant protein was soluble, which facilitated its purification and characterization . Similar strategies may be applicable to plsY expression.

How can researchers effectively address experimental inconsistencies in plsY activity measurements?

Variability in enzyme activity measurements is a common challenge in biochemical research. For recombinant plsY, several strategies can minimize experimental inconsistencies:

Standardization Approaches:

  • Establish clear reference standards and positive controls

  • Implement rigorous enzyme storage protocols

  • Control environmental variables (temperature, pH, ionic strength)

  • Use multiple complementary assay methods to confirm results

Statistical Considerations:

Source of VariationControl MethodExpected Impact
Enzyme preparationStandardized purificationReduces batch-to-batch variation
Substrate qualityHPLC verification of purityEnsures consistent reaction initiation
Assay componentsPrepare master mixesMinimizes pipetting errors
Instrument variationRegular calibrationProduces comparable data over time

Data Validation:

  • Perform biological and technical replicates (minimum n=3)

  • Apply appropriate statistical tests (ANOVA, t-tests)

  • Consider Michaelis-Menten kinetics to characterize enzyme behavior fully

  • Compare results with published data on related enzymes when available

What approaches can resolve difficulties in determining the membrane topology and structure of recombinant plsY?

Membrane proteins like plsY present unique structural characterization challenges. Several complementary approaches can be employed to determine topology and structure:

Experimental Approaches:

  • Cysteine Scanning Mutagenesis:

    • Systematic replacement of residues with cysteine

    • Accessibility testing with membrane-permeable and -impermeable reagents

    • Mapping of transmembrane regions

  • Fusion Protein Analysis:

    • Creation of reporter fusions (GFP, alkaline phosphatase)

    • Determination of reporter accessibility to different cellular compartments

    • Inference of protein orientation

  • Advanced Structural Methods:

    MethodResolutionAdvantagesLimitations
    X-ray CrystallographyVery highAtomic-level detailDifficult crystallization
    Cryo-EMModerate to highNative-like conditionsSample preparation challenges
    NMR SpectroscopyModerateDynamic informationSize limitations
    Computational ModelingVariableNo experimental sample requiredRequires validation
  • Biochemical Approaches:

    • Protease protection assays

    • Antibody epitope mapping

    • Chemical cross-linking combined with mass spectrometry

These techniques can be applied individually or in combination to build a comprehensive structural model of plsY, informing both functional understanding and potential applications in antimicrobial development.

How might genetic engineering of O. anthropi plsY contribute to understanding phospholipid biosynthesis regulation?

Genetic engineering approaches offer powerful tools for investigating plsY's role in phospholipid biosynthesis regulation:

Site-Directed Mutagenesis Studies:

  • Targeted modification of catalytic residues to establish structure-function relationships

  • Alteration of regulatory domains to understand allosteric control

  • Creation of chimeric enzymes with domains from other species to assess functional conservation

Regulatory Circuit Analysis:

  • Integration of plsY variants under inducible promoters

  • Real-time monitoring of phospholipid composition changes

  • Investigation of feedback mechanisms controlling enzyme activity

Potential Research Outcomes:

Engineering ApproachResearch QuestionExpected Insight
Catalytic site mutationsHow do specific residues contribute to substrate specificity?Structure-function relationships
Expression level modulationHow does plsY abundance affect membrane composition?Regulatory network understanding
Chimeric constructsWhich domains determine species-specific functions?Evolutionary adaptations

These approaches could build upon existing knowledge of O. anthropi as a model organism for studying bacterial systems and extend our understanding of membrane biosynthesis pathways.

What potential biotechnological applications exist for engineered variants of O. anthropi plsY?

Engineered variants of plsY from O. anthropi may have several biotechnological applications based on the enzyme's fundamental role in lipid biosynthesis:

Biocatalysis Applications:

  • Production of specialized lysophospholipids for pharmaceutical or cosmetic applications

  • Synthesis of custom phospholipids with defined fatty acid compositions

  • Generation of novel lipid structures through altered substrate specificity

Industrial Potential:

  • Development of enzyme variants with enhanced stability for industrial processes

  • Creation of engineered strains for bioremediation applications, building on O. anthropi's known capabilities in degrading environmental contaminants

  • Integration into synthetic biology platforms for renewable chemical production

Therapeutic Relevance:

Application AreaEngineered FeaturePotential Impact
Antimicrobial developmentStructural insights from recombinant enzymeNew drug targets
Lipid-based drug deliveryCustom phospholipid synthesisImproved pharmaceutical formulations
Diagnostic toolsEnzyme-based biosensorsDetection of lipid metabolites

O. anthropi's demonstrated abilities in biotechnological applications, such as biodegradation of xenobiotic compounds , suggest that its enzymes, including plsY, may have broad biotechnological potential.

How might systems biology approaches integrate plsY function into broader metabolic networks in O. anthropi?

Systems biology offers a comprehensive framework for understanding plsY's role within the broader metabolic landscape of O. anthropi:

Multi-omics Integration:

  • Genomics: Identification of regulatory elements controlling plsY expression

  • Transcriptomics: Expression patterns under various environmental conditions

  • Proteomics: Protein-protein interactions involving plsY

  • Metabolomics: Phospholipid profiles resulting from plsY activity

Metabolic Modeling:

  • Integration of plsY into genome-scale metabolic models

  • Flux balance analysis to predict consequences of plsY modulation

  • Identification of metabolic chokepoints where plsY activity is critical

Network Analysis:

Network LevelResearch ApproachExpected Insights
Gene regulatoryChIP-seq, transcription factor bindingRegulation of plsY expression
Protein interactionCo-immunoprecipitation, two-hybrid screeningMulti-enzyme complexes
MetabolicIsotope labeling, metabolic flux analysisCarbon flow through lipid pathways

This systems-level understanding could build upon existing knowledge of O. anthropi metabolism and its adaptability to different environments , providing a more complete picture of how phospholipid biosynthesis connects to broader cellular functions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.