Recombinant Ochrobactrum anthropi Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

General Information on Ochrobactrum anthropi

Ochrobactrum species are non-enteric, Gram-negative organisms closely related to the Brucella genus . Ochrobactrum anthropi is a Gram-negative bacillus, non-fermenting, an obligate aerobe, flagellate, oxidase-positive, and indole-negative .

  • Habitat O. anthropi thrives in the rhizosphere but does not multiply in host cells . It can be isolated from soil, water, human wastes, fluids, and medical devices .

  • Clinical Significance O. anthropi is an opportunistic pathogen, causing infections in severely ill or immunocompromised patients, often associated with indwelling catheterization . Infections include bacteremia, brain empyema, endophthalmitis, septic shock, septic arthritis, endocarditis, and retropharyngeal abscess .

  • Antibiotic Resistance O. anthropi exhibits inherent resistance to beta-lactams, making empirical treatment challenging . It is often susceptible to ciprofloxacin, aminoglycosides, trimethoprim-sulfamethoxazole, and carbapenems .

Identification of Ochrobactrum anthropi

Due to its phenotypic similarities with other microorganisms, microbiological characterization of O. anthropi can be difficult, leading to potential misdiagnoses .

  • Biochemical Identification Traditional biochemical tests may lead to misidentification .

  • Molecular Identification 16S ribosomal gene sequencing can accurately identify O. anthropi .

  • MALDI-TOF MS MALDI-TOF MS is increasingly used for Ochrobactrum identification in clinical settings, offering high similarity among isolates and accuracy in identification .

Mechanosensitive Channels (MscL)

Mechanosensitive channels (MscLs) are membrane proteins that respond to mechanical stimuli, such as changes in membrane tension. MscLs are found in various organisms, including bacteria, and play a crucial role in maintaining cellular homeostasis by allowing the passage of ions and small molecules across the cell membrane in response to mechanical stress.

Recombinant MscL

Recombinant MscL is produced using genetic engineering techniques, where the gene encoding the MscL protein from Ochrobactrum anthropi is inserted into a host organism (e.g., E. coli) for expression and purification. This allows researchers to study the structure, function, and regulation of the channel in a controlled environment.

Significance of Recombinant Ochrobactrum anthropi MscL

The study of MscL from Ochrobactrum anthropi and other bacteria has provided insights into the mechanisms of mechanosensation and the role of these channels in bacterial survival and adaptation. MscLs are potential targets for developing new antimicrobial agents.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; Oant_0410; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / JCM 21032 / NBRC 15819 / NCTC 12168)
Target Names
mscL
Target Protein Sequence
MLKEFKEFALKGNMVDLAIGVIIGGAFGGLVNSIVNDIIMPIIGLITGGIDFSNMFIQLA GEPRATLAAAREAGATIAYGNFVTLLINFLIIAWVLFLVVKGMNRMKKKEEAKPEPEAPR EEVLLTEIRDLLAKQKA
Uniprot No.

Target Background

Function
A membrane channel activated by stretch forces in the lipid bilayer. It likely plays a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.