Recombinant Ochrobactrum anthropi NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Electron Transport Activity

nuoK participates in the NADH dehydrogenase complex, which transfers electrons from NADH to quinones (e.g., ubiquinone) in the bacterial inner membrane. This process is coupled to proton translocation, contributing to ATP synthesis .

  • Catalytic Mechanism: Facilitates electron transfer via coordination with other subunits (e.g., nuoB, nuoH) and flavin cofactors .

  • Substrate Specificity: Primarily reduces quinones but may interact with other electron acceptors under stress conditions .

Comparative Analysis with Related Proteins

ProteinOrganismKey Differences
Helicobacter pylori nuoKHelicobacter pyloriAmino acid sequence differs (e.g., Q1CRZ1 vs. O. anthropi A6X1M3)
NQO1 (DT-diaphorase)HumansUses NAD(P)H and NRH as cofactors; lacks proton translocation
  • ELISA Kits: Used to detect nuoK-specific antibodies in serological studies .

  • Enzyme Kinetics: Studied in vitro to elucidate electron transfer mechanisms and inhibitor binding (e.g., dicoumarol) .

Ochrobactrum anthropi as a Host Organism

O. anthropi is a Gram-negative, urease-positive bacterium associated with opportunistic infections in immunocompromised patients . Its genome includes plasmids encoding transporters and metabolic genes, which may enhance survival in diverse environments .

Relevance of nuoK in O. anthropi

While nuoK is not directly linked to virulence, its role in energy metabolism underscores the importance of Complex I in bacterial adaptation. Mutations in analogous subunits (e.g., NQO1 in humans) are associated with reduced enzyme stability and disease susceptibility .

Challenges and Future Directions

  • Structural Elucidation: Limited crystallographic data for O. anthropi nuoK compared to human NQO1 .

  • Biotechnological Potential: Potential applications in biofuel production or antimicrobial resistance studies remain unexplored .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If a specific tag type is required, please inform us, and we will prioritize its inclusion in the production process.
Synonyms
nuoK; Oant_2413; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / JCM 21032 / NBRC 15819 / NCTC 12168)
Target Names
nuoK
Target Protein Sequence
MEIGIAHYLTVSAILFTLGVFGIFLNRKNVIVILMSIELILLSVNLNFVAFSSQLGDMVG QVFALFVLTVAAAEAAIGLAILVVFFRNRGSIAVEDVNVMKG
Uniprot No.

Target Background

Function

NDH-1 (NADH-quinone oxidoreductase subunit K) facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, ubiquinone is believed to be the primary electron acceptor. This redox reaction is coupled with proton translocation; for every two electrons transferred, four protons are translocated across the cytoplasmic membrane, thus establishing a proton gradient that conserves redox energy.

Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.