Recombinant Ochrobactrum anthropi Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your required tag type for preferential development.
Synonyms
kdpC; Oant_3778; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / JCM 21032 / NBRC 15819 / NCTC 12168)
Target Names
kdpC
Target Protein Sequence
MLKQLRPALVMIVSLTVITGLLYPLGMTGIAQVIFPANANGSLIEKDGTIIGSELIGQGF TGDRYFHGRPSAAGQNGYDAASSGGSNLGPTNPKLIERIKADATALSQDEGSARPPIDLV TTSASGLDPHISPETAFYQVPRVAKARGIDEAALREIVEQQVEARELGFLGEPVVNVLKL NLVLDRTSTK
Uniprot No.

Target Background

Function
The Recombinant *Ochrobactrum anthropi* Potassium-transporting ATPase C chain (KdpC) is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis, coupled with the electrogenic transport of potassium ions into the cytoplasm. KdpC functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATPase subunit KdpB by forming a transient KdpB/KdpC/ATP ternary complex.
Database Links
Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Ochrobactrum anthropi and why is it relevant for KdpC research?

Ochrobactrum anthropi is an oxidase-producing, non-lactose-fermenting, gram-negative bacillus commonly isolated from environmental sources including sinks, baths, soil, and hospital water sources . This organism has gained significant scientific interest due to its remarkable bioremediation capabilities, particularly its ability to degrade organophosphorus pesticides, phenol, toxic organic solvents, petroleum waste, and soil contaminants . O. anthropi also demonstrates capacity for removing heavy metals including chromium, cadmium, and copper from the environment, making it ecologically valuable . The potassium-transporting systems in this organism, particularly the KdpFABC complex which includes the KdpC chain, are essential for its survival in potassium-limited environments and potentially contribute to its environmental adaptability.

What is the structural and functional role of KdpC in the KdpFABC complex?

The KdpC chain functions as an integral component of the KdpFABC complex, which represents a unique chimeric system combining features of both a primary active P-type ATPase and an ion channel . Structurally, KdpC is positioned in proximity to the selectivity filter of the complex and appears to function similarly to β subunits observed in Na+/K+ ATPases and gastric H+ ATPases . Its primary functional role involves increasing potassium affinity, a hypothesis first proposed nearly three decades ago and supported by recent structural studies . Unlike other components of the complex that undergo significant conformational changes during the transport cycle, KdpC maintains a relatively stable position, suggesting its role is primarily regulatory rather than mechanically active in the potassium transport process.

How do you establish an effective gene expression system for Ochrobactrum anthropi KdpC?

Genetic studies of Ochrobactrum anthropi have historically been limited by the absence of suitable gene expression systems . The most effective approach involves constructing specialized vectors containing multiple promoters and an N-terminal His-tag fusion to facilitate both protein detection and subsequent purification . Standard recombinant DNA methods should be employed, utilizing high-fidelity polymerase chain reaction (PCR) systems such as Platinum PCR SuperMix High Fidelity for gene amplification . The vector construction should incorporate restriction sites compatible with O. anthropi, and appropriate antibiotic resistance markers should be included for selection purposes. Plasmid extraction and cleanup can be efficiently performed using commercial kits such as QIAprep spin miniprep kits and QIAGEN PCR cleanup kits, respectively .

What are the optimal growth conditions for maximizing recombinant KdpC expression in O. anthropi?

For optimal expression of recombinant KdpC in Ochrobactrum anthropi, researchers should consider several key parameters. The bacterium should be cultured in nutrient-rich media supplemented with appropriate selective antibiotics to maintain the expression vector. Temperature regulation is critical, with optimal growth typically occurring at 28-30°C for O. anthropi, though expression may be induced at slightly lower temperatures (20-25°C) to enhance protein folding and solubility . Potassium concentration in the growth medium should be carefully controlled, as low potassium conditions naturally induce the KdpFABC complex expression. For inducible promoter systems, the concentration and timing of inducer addition must be optimized through experimental trials, with mid-log phase (OD600 of 0.4-0.6) generally producing the highest protein yields while minimizing inclusion body formation.

How do you verify successful expression of recombinant KdpC protein?

Verification of successful recombinant KdpC expression requires a multi-faceted approach. The primary method involves Western blot analysis using either antibodies specific to the KdpC protein or, more commonly, antibodies targeting the incorporated His-tag . SDS-PAGE can be used to assess protein size and relative abundance, with expected KdpC molecular weight of approximately 20-25 kDa depending on fusion tags. Additionally, functional verification can be performed through complementation studies in KdpC-deficient strains to confirm that the recombinant protein retains biological activity. For more precise quantification, ELISA or mass spectrometry approaches can determine exact protein concentrations and verify the complete amino acid sequence. RT-PCR or Northern blot analysis may also be employed to verify transcription of the kdpC gene prior to protein expression analysis.

How does the KdpC subunit contribute to potassium transport mechanism in the KdpFABC complex?

The KdpC subunit plays a sophisticated regulatory role in the KdpFABC complex's potassium transport mechanism. Unlike classical P-type ATPases, the KdpFABC complex employs a novel mechanism where the ion channel pore remains closed while potassium ions are redirected through the P-type ATPase subunit . Based on cryo-EM structural studies, KdpC appears to enhance the affinity of the complex for potassium ions, particularly at the selectivity filter region . The complex operates through an alternating access mechanism with outward-facing E1 and inward-facing E2 states, which is notably reversed compared to classical P-type ATPases . In this process, potassium ions are attracted with high affinity to the selectivity filter in KdpA and move along the outward-open half-channel in the E1 state, with KdpC maintaining structural stability throughout the transport cycle while influencing ion binding kinetics. This mechanism allows the complex to efficiently pump potassium ions even against concentration gradients as high as 10^4 .

What challenges exist in resolving contradictory data regarding the KdpFABC transport cycle?

Several significant contradictions exist in the current understanding of the KdpFABC transport cycle that researchers must address. The proposed mechanism suggesting ion redirection through the P-type ATPase subunit contradicts functional studies by Siebers and Altendorf, which demonstrated maximal phosphorylation of the KdpFABC complex upon ATP addition in potassium-free conditions, while potassium addition induced dephosphorylation . This fundamental discrepancy suggests either multiple operational modes or context-dependent mechanisms that have not been fully characterized. Additionally, the direction of the reaction cycle remains disputed, with some evidence supporting the reversed alternating access model while other studies favor the classical reaction cycle . Resolving these contradictions requires integrated approaches combining advanced structural techniques (cryo-EM, X-ray crystallography) with comprehensive functional assays under various physiological conditions. Researchers should design experiments that can specifically test competing hypotheses, perhaps using site-directed mutagenesis to alter key residues involved in the proposed mechanisms.

What purification strategy is most effective for recombinant His-tagged KdpC?

The most effective purification strategy for recombinant His-tagged KdpC employs a multi-step approach optimized for membrane-associated proteins. Initial cell lysis should be performed using either sonication or pressure-based disruption methods in a buffer containing mild detergents (0.5-1% n-dodecyl β-D-maltoside or CHAPS) to solubilize membrane components without denaturing the protein structure . The primary purification step utilizes Immobilized Metal Affinity Chromatography (IMAC) with Ni-NTA or Co-NTA resin, exploiting the high affinity of the His-tag for divalent metal ions . A typical purification protocol includes:

Purification StepBuffer CompositionConditionsPurpose
Cell Lysis50 mM Tris-HCl pH 8.0, 300 mM NaCl, 0.5% detergent, 10% glycerol, protease inhibitors4°C, sonication or French pressRelease protein while maintaining structure
IMAC BindingLysis buffer + 10 mM imidazole4°C, 1-2 hours or overnightSelective binding to resin
IMAC WashLysis buffer + 20-50 mM imidazole10-20 column volumesRemove non-specific binding proteins
IMAC ElutionLysis buffer + 250-500 mM imidazoleCollect 0.5-1 mL fractionsElute purified protein
Size Exclusion25 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.1% detergent, 5% glycerolFlow rate 0.5 mL/minRemove aggregates and further purify

This protocol typically yields protein with >90% purity, suitable for structural and functional characterization.

What structural characterization techniques provide the most valuable insights into KdpC function?

Multiple structural characterization techniques provide complementary insights into KdpC function within the KdpFABC complex. Cryo-electron microscopy (cryo-EM) has proven particularly valuable for resolving the complex in different conformational states, revealing how KdpC positions relative to other subunits during the transport cycle . X-ray crystallography, while challenging due to membrane protein crystallization difficulties, provides atomic-resolution details of key binding interfaces. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can identify regions of KdpC that undergo conformational changes or are involved in protein-protein interactions. Circular dichroism spectroscopy helps assess secondary structure composition and stability under various conditions. Cross-linking mass spectrometry can map spatial relationships between KdpC and other complex components. Small-angle X-ray scattering (SAXS) provides low-resolution envelope information about the complex in solution. Each technique addresses different structural questions, with the combination of cryo-EM and targeted cross-linking studies currently offering the most comprehensive structural insights into KdpC's functional role.

How should researchers interpret changes in KdpC expression levels in response to environmental potassium availability?

Changes in KdpC expression levels in response to environmental potassium availability should be interpreted within the context of the regulatory network controlling the KdpFABC complex. Researchers should establish a baseline expression profile across a range of potassium concentrations (typically from 0.1 mM to 10 mM K+) using quantitative techniques such as qRT-PCR for transcript analysis and Western blotting for protein levels. A typical response pattern shows inverse correlation between expression levels and environmental potassium, with significant upregulation occurring below 1 mM K+ concentration . Kinetic analysis of this response reveals important information about regulatory thresholds and adaptation rates. Deviations from expected expression patterns might indicate mutations in regulatory elements or cross-talk with other stress response systems. When analyzing expression data, researchers should consider not just absolute KdpC levels but also the stoichiometric relationship with other Kdp subunits, as imbalanced expression could lead to incomplete complex formation and reduced functionality.

What statistical approaches are most appropriate for analyzing KdpC transport kinetics data?

Statistical analysis of KdpC transport kinetics requires specialized approaches tailored to biochemical rate processes. For basic kinetic parameters, non-linear regression analysis should be applied to transport rate versus substrate concentration data to determine Km and Vmax values using the Michaelis-Menten equation or its derivatives for more complex kinetics . When comparing multiple experimental conditions or mutant variants, Analysis of Variance (ANOVA) followed by appropriate post-hoc tests (Tukey's or Dunnett's) helps identify statistically significant differences. For time-series data from potassium uptake experiments, segmented regression analysis can identify changes in transport rates under varied conditions, similar to approaches used in other biological rate assessments . The table below summarizes appropriate statistical approaches for different types of transport kinetics data:

Data TypeStatistical ApproachSoftware ToolsConsiderations
Enzyme KineticsNon-linear regression (Michaelis-Menten, Hill equation)GraphPad Prism, SigmaPlotAccount for substrate depletion effects
Multiple Condition ComparisonsANOVA with post-hoc testsR, SAS, SPSSVerify assumptions of normality and homoscedasticity
Time-Series TransportSegmented regression analysisSAS PROC GENMODConsider autocorrelation in residuals
State Transition AnalysisMarkov modelingMATLAB, RRequires sufficient state sampling

How can researchers integrate structural and functional data to develop comprehensive models of KdpC's role in potassium transport?

Integrating structural and functional data to model KdpC's role requires a multi-scale computational approach. Researchers should begin by mapping functional data from mutagenesis and kinetic studies onto resolved structural elements from cryo-EM or crystallography studies . Molecular dynamics simulations can then predict conformational changes and energy landscapes of potassium transport, with KdpC's influence parameterized based on experimental binding and kinetic data. Statistical coupling analysis can identify co-evolving residues between KdpC and other subunits, highlighting functionally important interfaces. Bayesian network analysis helps integrate diverse experimental datasets with different confidence levels to create probability-weighted functional models. The proposed transport mechanism should account for both structural constraints and observed kinetics, particularly addressing how KdpC influences potassium binding without undergoing major conformational changes itself . When conflicts arise between structural predictions and functional observations, researchers should develop testable hypotheses to resolve these contradictions rather than discarding outlier data, as these discrepancies often reveal novel mechanistic insights.

What are the most promising future research directions for Ochrobactrum anthropi KdpC studies?

The most promising future research directions for Ochrobactrum anthropi KdpC studies span multiple scientific domains. High-resolution structural characterization of the KdpFABC complex in additional conformational states will provide crucial insights into the complete transport cycle, potentially resolving current contradictions in the proposed mechanisms . Development of improved gene expression systems specifically optimized for O. anthropi will facilitate more efficient protein production and genetic manipulation capabilities . Comparative studies of KdpC across different bacterial species, particularly those adapted to extreme environments, may reveal evolutionary adaptations in potassium transport mechanisms. Investigation of potential applications in bioremediation processes should explore how the KdpFABC complex contributes to O. anthropi's remarkable ability to survive in contaminated environments containing heavy metals and toxic organic compounds . Systems biology approaches integrating transcriptomics, proteomics, and metabolomics will provide comprehensive understanding of how KdpC regulation integrates with broader cellular responses to environmental stresses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.