The Recombinant Ochrobactrum anthropi Protein CrcB homolog (crcB) is a recombinant version of a bacterial protein involved in fluoride ion detoxification. CrcB is part of a conserved regulatory system—the fluoride riboswitch (crcB RNA motif)—that enables bacteria to respond to fluoride toxicity by modulating downstream gene expression . This protein is primarily studied for its role in mitigating fluoride-induced stress in Ochrobactrum anthropi, an environmentally ubiquitous Gram-negative bacterium with opportunistic pathogenic potential .
The recombinant CrcB homolog is derived from Ochrobactrum anthropi strain ATCC 49188 (DSM 6882 / NCTC 12168) . Key structural features include:
Amino Acid Sequence:
MQATLMVALGGAIGSVARYWLALLmLPISRELPWGTIVINIAGSFAISFFGALTLEQGRF PIPEIWRLAFMVGVCGGFTTFSSFSLQTMDLLRAGQPGKALFNIGFSVVLCLIAVWLGLL AAERFNGGIEQVAQNVIEEEAS (142 residues) .
Expression System: Recombinant protein produced via heterologous expression, optimized for use in ELISA assays .
Fluoride Detection: The riboswitch binds fluoride, altering RNA structure.
Gene Regulation: Downstream genes (e.g., crcB, eric^F^) are transcribed to mitigate toxicity .
The recombinant CrcB protein is used in ELISA kits to detect antibodies against Ochrobactrum anthropi or fluoride-responsive pathogens. This application leverages the protein’s conserved sequence and immunogenic properties .
Fluoride Resistance Mechanisms: CrcB’s role in fluoride efflux has been inferred from comparative genomics and riboswitch studies .
Cross-Species Relevance: Fluoride riboswitches are widespread in bacteria, including Streptococcus mutans, suggesting evolutionary conservation of fluoride response systems .
Bioremediation: CrcB homologs could be engineered to enhance fluoride removal in contaminated environments.
Diagnostic Markers: The protein’s specificity may aid in identifying Ochrobactrum anthropi infections or fluoride-exposed microbial communities .
| Position (1–50) | Sequence |
|---|---|
| 1–20 | MQATLMVALGGAIGSVARYWLAL |
| 21–40 | LPISRELPWGTIVINIAGSFAI |
| 41–60 | SFFGALTLEQGRFPIPEIWRLA |
| 61–80 | FMVGVCGGFTTFSSFSLQTMDL |
| 81–100 | LRAGQPGKALFNIGFSVVLCL |
| 101–120 | IAVWLGLLAAERFNGGIEQVAQ |
| 121–142 | NVIEEEAS (truncated) |
Crucial in reducing intracellular fluoride concentration, thereby mitigating its toxicity.
KEGG: oan:Oant_3612
STRING: 439375.Oant_3612
Ochrobactrum anthropi is a versatile bacterial species with strains living in diverse habitats and is increasingly recognized as an opportunistic pathogen in hospitalized patients . The bacterium possesses a complex population structure with evidence of both clonal complexes and recombination events . The CrcB homolog, while not specifically characterized in the provided materials, likely plays a role in fluoride ion transport mechanisms based on conserved bacterial protein functions. Research on this protein may provide insights into bacterial adaptation mechanisms, particularly as O. anthropi has been shown to possess a human-associated lineage that suggests specialized adaptation to human hosts .
Identification of O. anthropi presents significant challenges due to its close phylogenetic relationship with other bacteria, particularly Brucella spp. Traditional microbiological tests can lead to misidentification due to shared phenotypic characteristics including gram-negative morphology, non-fermenting obligate aerobe metabolism, and positive catalase and urease tests . For reliable identification, a multi-method approach is recommended:
Molecular identification using 16S ribosomal gene sequencing (particularly targeting the 510 bp segment)
Phylogenetic analysis comparing sequences against reference strains
Multi-Locus Sequence Typing (MLST) targeting 7 housekeeping genes (3490 nucleotides total)
Supplementary genomic fingerprinting by pulsed-field gel electrophoresis (PFGE)
Despite similar molecules in their outer membranes, O. anthropi and Brucella differ in the chemical structures of their lipid A cores, which can be used for differentiation in specialized tests .
Based on O. anthropi's physiological characteristics, the following culture conditions are recommended for optimal recombinant protein expression:
These conditions should be optimized for each specific protein construct, with particular attention to solubility issues that may require further optimization of temperature, induction strength, or addition of solubility-enhancing tags.
O. anthropi displays a complex population structure with evidence of both clonal lineages and recombination events . This genetic heterogeneity has significant implications for recombinant protein research:
MLST analysis of O. anthropi has revealed an epidemic population structure with major clonal complexes, including a human-associated lineage composed exclusively of clinical isolates . When working with the CrcB homolog, researchers should consider:
Source strain selection: The genetic background of the source strain may affect protein sequence and function. MLST data suggests selecting strains from the major clonal complex if studying human-relevant functions, or comparing proteins from different lineages to understand adaptive variations.
Recombination impacts: Split decomposition analysis has shown network-like structures with evidence of recombination events, particularly within clonal complexes . This suggests potential sequence variation in functional genes like crcB that may affect protein structure and function.
Methodological approach:
Clone and express crcB from multiple isolates representing different phylogenetic lineages
Compare sequence variations with functional differences using site-directed mutagenesis
Consider codon optimization based on the expression system, as O. anthropi may have different codon preferences than common expression hosts
The standardized Index of Association (sIA) for O. anthropi (0.2402 for unique sequence types) indicates linkage disequilibrium consistent with a population undergoing limited recombination , suggesting potential co-evolution of genes that may affect the functional context of CrcB.
Purifying membrane proteins like the CrcB homolog presents specific challenges. Based on the characteristics of O. anthropi and membrane proteins:
| Purification Step | Recommended Method | Critical Parameters |
|---|---|---|
| Cell lysis | Mechanical (French press or sonication) | Buffer containing 20mM Tris-HCl pH 8.0, 150mM NaCl, with protease inhibitors |
| Membrane fraction isolation | Ultracentrifugation (100,000 × g, 1h) | Complete removal of cytosolic proteins |
| Solubilization | Mild detergents (DDM, LMNG, or C12E8) | Detergent concentration 1-2% for extraction, 0.1-0.05% for purification |
| Affinity chromatography | IMAC (Ni-NTA) if His-tagged | Gradient elution to minimize co-purification |
| Size exclusion | Superdex 200 | Assess oligomeric state and homogeneity |
| Stability assessment | Thermal shift assay | Optimize buffer conditions for maximum stability |
Special considerations for CrcB homologs:
Monitor protein functionality using fluoride binding assays
Consider addition of stabilizing lipids during purification
Evaluate detergent exchange prior to structural studies
For crystallography, consider using antibody fragments to increase crystal contacts
O. anthropi is increasingly recognized as an opportunistic pathogen in hospitalized patients , requiring careful laboratory practices:
Biosafety considerations:
Work at BSL-2 conditions
Use dedicated equipment and containment procedures
Implement proper decontamination protocols for all waste
Contamination prevention in recombinant systems:
Use codon-optimized synthetic genes rather than direct cloning from O. anthropi
Implement rigorous quality control of expression systems
Validate recombinant protein identity by mass spectrometry
Endotoxin management:
Cross-reactivity considerations:
A comprehensive approach to characterizing CrcB homolog should include:
In silico analysis:
Phylogenetic comparison with characterized CrcB proteins
Structural prediction and identification of conserved functional domains
Genomic context analysis to identify potential functional partners
Expression analysis:
qRT-PCR to measure expression under various conditions (fluoride exposure, pH stress)
Promoter-reporter fusions to identify regulatory elements
Proteomics to assess expression levels and post-translational modifications
Functional characterization:
Gene knockout studies using CRISPR-Cas9 or homologous recombination
Complementation assays with wild-type and mutant variants
Fluoride sensitivity assays comparing wild-type and mutant strains
Electrophysiology studies with purified protein in lipid bilayers
Interaction studies:
Co-immunoprecipitation to identify protein partners
Bacterial two-hybrid assays to confirm direct interactions
Crosslinking mass spectrometry to map interaction surfaces
The epidemic population structure of O. anthropi suggests comparing CrcB homologs across different lineages, particularly between environmental and clinical isolates, to identify adaptive changes.
Multi-Locus Sequence Typing provides valuable information for strain selection:
Strategic strain selection:
Data interpretation:
MLST analysis of O. anthropi indicates an epidemic population structure
The standardized Index of Association (sIA = 0.2402) indicates linkage disequilibrium despite evidence of recombination
Split decomposition analysis shows a network-like structure indicating recombination mostly within clonal complexes
Methodological approach for strain selection:
Perform MLST on candidate strains using the established 7-gene scheme
Construct phylogenetic trees to visualize relationships
Select strains that represent diverse evolutionary lineages
Consider including strains that show evidence of recombination in genes of interest
Considerations for protein studies:
Sequence the crcB gene from selected strains to assess conservation
Compare crcB sequences with MLST phylogeny to identify potential horizontal gene transfer
Clone variants from different lineages to assess functional differences
Understanding protein-protein interactions of membrane proteins like CrcB requires specialized approaches:
In vivo approaches:
Bacterial two-hybrid systems adapted for membrane proteins (BACTH)
Protein fragment complementation assays (PCA) using split GFP or split luciferase
In vivo crosslinking with photo-activatable amino acids
Proximity-dependent biotin identification (BioID) adapted for bacterial systems
In vitro approaches:
Co-purification assays using tandem affinity tags
Surface plasmon resonance with nanodiscs or liposomes
Microscale thermophoresis for detecting interactions in detergent solutions
Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces
Structural approaches:
Cryo-electron microscopy of purified complexes
X-ray crystallography of co-purified partners
Solid-state NMR of reconstituted membrane complexes
Data validation:
Confirm interactions using multiple orthogonal techniques
Perform mutagenesis of predicted interaction sites
Assess functional relevance through phenotypic analysis of interaction-deficient mutants
Since O. anthropi shows evidence of recombination and has a clonal population structure , consider investigating whether interaction partners co-evolve with CrcB variants from different lineages.
O. anthropi can be misidentified using traditional methods, particularly being confused with Brucella spp. . When faced with conflicting results:
Resolution approach for contradictory identification:
Understanding the basis for misidentification:
O. anthropi and Brucella share phenotypic characteristics (gram-negative morphology, non-fermenting metabolism, positive catalase and urease tests)
Similar molecules exist in their outer membranes, including phosphatidylcholine and LPS components
Differences exist in their lipid A core structures, which can be used for differentiation
Quality control measures:
Implications for recombinant protein research:
Verify the source organism before cloning genes
Sequence the target gene to confirm identity
Consider synthetic gene synthesis based on verified sequences
When analyzing genetic variation in CrcB homologs:
Population genetics metrics:
Phylogenetic approaches:
Recombination analysis:
Apply methods for detecting recombination breakpoints (RDP, MaxChi, Bootscan)
Calculate the ratio of recombination to mutation (r/m) rates
Identify potential donor sequences for recombination events
Structure-function correlation:
Map sequence variations to predicted structural domains
Conduct coevolutionary analysis to identify functionally linked residues
Correlate genetic variants with habitat (clinical vs environmental) to identify adaptive changes
For O. anthropi, these approaches should consider the epidemic population structure with evidence of both clonal expansion and recombination , which may affect interpretation of genetic diversity patterns.
Integrating multiple omics datasets provides comprehensive insights:
Data types and collection strategies:
Genomics: Whole genome sequencing of multiple strains to place crcB in genomic context
Transcriptomics: RNA-seq under various conditions (fluoride exposure, pH stress, host interaction)
Proteomics: Quantitative proteomics to measure expression levels and post-translational modifications
Metabolomics: Assess metabolic changes associated with crcB expression or deletion
Integration approaches:
Multi-layer network analysis to identify functional modules
Correlation analysis across omics layers
Causal network inference to predict regulatory relationships
Machine learning approaches to identify predictive signatures
Visualization and interpretation:
Integrated pathway mapping using tools like PathVisio or KEGG
Multi-omics data browsers to explore relationships
Circular visualization of genomic context and expression data
Functional validation:
Target validation of predicted functional partners through knockout studies
Confirmation of regulatory relationships through promoter analysis
Testing of predicted metabolic impacts through targeted metabolomics
This approach is particularly valuable for O. anthropi given its complex population structure with evidence of both clonal expansion and recombination , which may result in lineage-specific functional networks.
Based on community-engaged research principles:
Partnership formation and maintenance:
Ethical considerations for O. anthropi research:
Address potential risks of studying an opportunistic pathogen
Develop biosafety protocols appropriate for community settings
Consider implications of findings for healthcare facilities and vulnerable populations
Research agenda development:
Research design and implementation:
The community-based participatory research (CBPR) model provides a framework where community partners have equal authority and responsibility with academic researchers , which is particularly important when studying opportunistic pathogens that may impact public health.
Effective communication strategies include:
Scientific community communication:
Peer-reviewed publications with comprehensive methodologies
Conference presentations highlighting key findings
Data repositories for sharing sequence and structural information
Open access publication when possible to maximize accessibility
Healthcare stakeholder communication:
Translational summaries focusing on clinical relevance
Briefing documents explaining implications for infection control
Workshops for healthcare providers on identification and management
Public health and community communication:
Lay summaries avoiding technical jargon
Visual representations of key concepts
Community forums for discussing implications
Transparent discussion of limitations and uncertainties
Policy and regulatory communication:
Evidence summaries with clear policy implications
Cost-benefit analyses of implementation strategies
Guidance documents for laboratory identification
When communicating about O. anthropi, emphasize its dual nature as both an environmental organism and an opportunistic pathogen with a human-associated lineage , while avoiding creating undue alarm about a relatively uncommon pathogen.