Recombinant Ochrobactrum anthropi Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Description

Introduction

The Recombinant Ochrobactrum anthropi Protein CrcB homolog (crcB) is a recombinant version of a bacterial protein involved in fluoride ion detoxification. CrcB is part of a conserved regulatory system—the fluoride riboswitch (crcB RNA motif)—that enables bacteria to respond to fluoride toxicity by modulating downstream gene expression . This protein is primarily studied for its role in mitigating fluoride-induced stress in Ochrobactrum anthropi, an environmentally ubiquitous Gram-negative bacterium with opportunistic pathogenic potential .

Protein Structure and Sequence

The recombinant CrcB homolog is derived from Ochrobactrum anthropi strain ATCC 49188 (DSM 6882 / NCTC 12168) . Key structural features include:

  • Amino Acid Sequence:
    MQATLMVALGGAIGSVARYWLALLmLPISRELPWGTIVINIAGSFAISFFGALTLEQGRF PIPEIWRLAFMVGVCGGFTTFSSFSLQTMDLLRAGQPGKALFNIGFSVVLCLIAVWLGLL AAERFNGGIEQVAQNVIEEEAS (142 residues) .

  • Uniprot ID: A6X514 .

  • Expression System: Recombinant protein produced via heterologous expression, optimized for use in ELISA assays .

Mechanism:

  1. Fluoride Detection: The riboswitch binds fluoride, altering RNA structure.

  2. Gene Regulation: Downstream genes (e.g., crcB, eric^F^) are transcribed to mitigate toxicity .

4.1. ELISA-Based Antibody Detection

The recombinant CrcB protein is used in ELISA kits to detect antibodies against Ochrobactrum anthropi or fluoride-responsive pathogens. This application leverages the protein’s conserved sequence and immunogenic properties .

4.2. Studies on Fluoride Toxicity

  • Fluoride Resistance Mechanisms: CrcB’s role in fluoride efflux has been inferred from comparative genomics and riboswitch studies .

  • Cross-Species Relevance: Fluoride riboswitches are widespread in bacteria, including Streptococcus mutans, suggesting evolutionary conservation of fluoride response systems .

4.3. Potential Biotechnological Uses

  • Bioremediation: CrcB homologs could be engineered to enhance fluoride removal in contaminated environments.

  • Diagnostic Markers: The protein’s specificity may aid in identifying Ochrobactrum anthropi infections or fluoride-exposed microbial communities .

Data Tables and Sequence Analysis

Table 2: Partial Amino Acid Sequence of CrcB Homolog

Position (1–50)Sequence
1–20MQATLMVALGGAIGSVARYWLAL
21–40LPISRELPWGTIVINIAGSFAI
41–60SFFGALTLEQGRFPIPEIWRLA
61–80FMVGVCGGFTTFSSFSLQTMDL
81–100LRAGQPGKALFNIGFSVVLCL
101–120IAVWLGLLAAERFNGGIEQVAQ
121–142NVIEEEAS (truncated)

Note: Full sequence spans 142 residues .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
crcB; Oant_3612; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-142
Protein Length
full length protein
Species
Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / JCM 21032 / NBRC 15819 / NCTC 12168)
Target Names
crcB
Target Protein Sequence
MQATLMVALGGAIGSVARYWLALLMLPISRELPWGTIVINIAGSFAISFFGALTLEQGRF PIPEIWRLAFMVGVCGGFTTFSSFSLQTMDLLRAGQPGKALFNIGFSVVLCLIAVWLGLL AAERFNGGIEQVAQNVIEEEAS
Uniprot No.

Target Background

Function

Crucial in reducing intracellular fluoride concentration, thereby mitigating its toxicity.

Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Ochrobactrum anthropi and why is the CrcB homolog protein significant for research?

Ochrobactrum anthropi is a versatile bacterial species with strains living in diverse habitats and is increasingly recognized as an opportunistic pathogen in hospitalized patients . The bacterium possesses a complex population structure with evidence of both clonal complexes and recombination events . The CrcB homolog, while not specifically characterized in the provided materials, likely plays a role in fluoride ion transport mechanisms based on conserved bacterial protein functions. Research on this protein may provide insights into bacterial adaptation mechanisms, particularly as O. anthropi has been shown to possess a human-associated lineage that suggests specialized adaptation to human hosts .

How can Ochrobactrum anthropi be reliably identified and distinguished from closely related species?

Identification of O. anthropi presents significant challenges due to its close phylogenetic relationship with other bacteria, particularly Brucella spp. Traditional microbiological tests can lead to misidentification due to shared phenotypic characteristics including gram-negative morphology, non-fermenting obligate aerobe metabolism, and positive catalase and urease tests . For reliable identification, a multi-method approach is recommended:

  • Molecular identification using 16S ribosomal gene sequencing (particularly targeting the 510 bp segment)

  • Phylogenetic analysis comparing sequences against reference strains

  • Multi-Locus Sequence Typing (MLST) targeting 7 housekeeping genes (3490 nucleotides total)

  • Supplementary genomic fingerprinting by pulsed-field gel electrophoresis (PFGE)

Despite similar molecules in their outer membranes, O. anthropi and Brucella differ in the chemical structures of their lipid A cores, which can be used for differentiation in specialized tests .

What are the optimal culture conditions for expressing recombinant O. anthropi proteins?

Based on O. anthropi's physiological characteristics, the following culture conditions are recommended for optimal recombinant protein expression:

ParameterRecommended ConditionRationale
Growth mediumLuria-Bertani (LB) or Tryptic Soy Broth (TSB)Supports robust growth of O. anthropi
Temperature28-30°CLower than standard E. coli conditions to maintain protein solubility
AerationHigh (150-200 rpm)O. anthropi is an obligate aerobe
Induction pointMid-log phase (OD600 0.6-0.8)Balances biomass and protein expression efficiency
Expression systempET or pBAD vectors in E. coli BL21(DE3)Common systems for expressing proteins from related alphaproteobacteria

These conditions should be optimized for each specific protein construct, with particular attention to solubility issues that may require further optimization of temperature, induction strength, or addition of solubility-enhancing tags.

How can genomic heterogeneity in O. anthropi populations impact recombinant protein expression and function?

O. anthropi displays a complex population structure with evidence of both clonal lineages and recombination events . This genetic heterogeneity has significant implications for recombinant protein research:

MLST analysis of O. anthropi has revealed an epidemic population structure with major clonal complexes, including a human-associated lineage composed exclusively of clinical isolates . When working with the CrcB homolog, researchers should consider:

  • Source strain selection: The genetic background of the source strain may affect protein sequence and function. MLST data suggests selecting strains from the major clonal complex if studying human-relevant functions, or comparing proteins from different lineages to understand adaptive variations.

  • Recombination impacts: Split decomposition analysis has shown network-like structures with evidence of recombination events, particularly within clonal complexes . This suggests potential sequence variation in functional genes like crcB that may affect protein structure and function.

  • Methodological approach:

    • Clone and express crcB from multiple isolates representing different phylogenetic lineages

    • Compare sequence variations with functional differences using site-directed mutagenesis

    • Consider codon optimization based on the expression system, as O. anthropi may have different codon preferences than common expression hosts

The standardized Index of Association (sIA) for O. anthropi (0.2402 for unique sequence types) indicates linkage disequilibrium consistent with a population undergoing limited recombination , suggesting potential co-evolution of genes that may affect the functional context of CrcB.

What are the most effective purification strategies for recombinant O. anthropi membrane proteins like CrcB homolog?

Purifying membrane proteins like the CrcB homolog presents specific challenges. Based on the characteristics of O. anthropi and membrane proteins:

Purification StepRecommended MethodCritical Parameters
Cell lysisMechanical (French press or sonication)Buffer containing 20mM Tris-HCl pH 8.0, 150mM NaCl, with protease inhibitors
Membrane fraction isolationUltracentrifugation (100,000 × g, 1h)Complete removal of cytosolic proteins
SolubilizationMild detergents (DDM, LMNG, or C12E8)Detergent concentration 1-2% for extraction, 0.1-0.05% for purification
Affinity chromatographyIMAC (Ni-NTA) if His-taggedGradient elution to minimize co-purification
Size exclusionSuperdex 200Assess oligomeric state and homogeneity
Stability assessmentThermal shift assayOptimize buffer conditions for maximum stability

Special considerations for CrcB homologs:

  • Monitor protein functionality using fluoride binding assays

  • Consider addition of stabilizing lipids during purification

  • Evaluate detergent exchange prior to structural studies

  • For crystallography, consider using antibody fragments to increase crystal contacts

How can researchers address potential contamination issues when working with O. anthropi-derived proteins?

O. anthropi is increasingly recognized as an opportunistic pathogen in hospitalized patients , requiring careful laboratory practices:

  • Biosafety considerations:

    • Work at BSL-2 conditions

    • Use dedicated equipment and containment procedures

    • Implement proper decontamination protocols for all waste

  • Contamination prevention in recombinant systems:

    • Use codon-optimized synthetic genes rather than direct cloning from O. anthropi

    • Implement rigorous quality control of expression systems

    • Validate recombinant protein identity by mass spectrometry

  • Endotoxin management:

    • O. anthropi shares LPS components with Brucella but with different lipid A structures

    • Implement endotoxin removal steps (Triton X-114 phase separation or specific endotoxin removal resins)

    • Validate endotoxin levels using LAL assays before use in cellular or animal models

  • Cross-reactivity considerations:

    • Due to antigenic similarities with Brucella, carefully validate antibodies used for detection

    • Consider epitope mapping to identify unique regions for generating specific antibodies

What experimental approaches are most effective for characterizing the function of CrcB homolog in O. anthropi?

A comprehensive approach to characterizing CrcB homolog should include:

  • In silico analysis:

    • Phylogenetic comparison with characterized CrcB proteins

    • Structural prediction and identification of conserved functional domains

    • Genomic context analysis to identify potential functional partners

  • Expression analysis:

    • qRT-PCR to measure expression under various conditions (fluoride exposure, pH stress)

    • Promoter-reporter fusions to identify regulatory elements

    • Proteomics to assess expression levels and post-translational modifications

  • Functional characterization:

    • Gene knockout studies using CRISPR-Cas9 or homologous recombination

    • Complementation assays with wild-type and mutant variants

    • Fluoride sensitivity assays comparing wild-type and mutant strains

    • Electrophysiology studies with purified protein in lipid bilayers

  • Interaction studies:

    • Co-immunoprecipitation to identify protein partners

    • Bacterial two-hybrid assays to confirm direct interactions

    • Crosslinking mass spectrometry to map interaction surfaces

The epidemic population structure of O. anthropi suggests comparing CrcB homologs across different lineages, particularly between environmental and clinical isolates, to identify adaptive changes.

How can researchers effectively use MLST data to select appropriate O. anthropi strains for recombinant protein studies?

Multi-Locus Sequence Typing provides valuable information for strain selection:

  • Strategic strain selection:

    • The MLST scheme for O. anthropi is based on 7 housekeeping genes totaling 3490 nucleotides

    • Identify strains from different sequence types (STs) to capture genetic diversity

    • Select representatives from the major clonal complex associated with human infections if studying host adaptation

  • Data interpretation:

    • MLST analysis of O. anthropi indicates an epidemic population structure

    • The standardized Index of Association (sIA = 0.2402) indicates linkage disequilibrium despite evidence of recombination

    • Split decomposition analysis shows a network-like structure indicating recombination mostly within clonal complexes

  • Methodological approach for strain selection:

    • Perform MLST on candidate strains using the established 7-gene scheme

    • Construct phylogenetic trees to visualize relationships

    • Select strains that represent diverse evolutionary lineages

    • Consider including strains that show evidence of recombination in genes of interest

  • Considerations for protein studies:

    • Sequence the crcB gene from selected strains to assess conservation

    • Compare crcB sequences with MLST phylogeny to identify potential horizontal gene transfer

    • Clone variants from different lineages to assess functional differences

What techniques are most appropriate for studying protein-protein interactions involving CrcB homolog in a bacterial membrane context?

Understanding protein-protein interactions of membrane proteins like CrcB requires specialized approaches:

  • In vivo approaches:

    • Bacterial two-hybrid systems adapted for membrane proteins (BACTH)

    • Protein fragment complementation assays (PCA) using split GFP or split luciferase

    • In vivo crosslinking with photo-activatable amino acids

    • Proximity-dependent biotin identification (BioID) adapted for bacterial systems

  • In vitro approaches:

    • Co-purification assays using tandem affinity tags

    • Surface plasmon resonance with nanodiscs or liposomes

    • Microscale thermophoresis for detecting interactions in detergent solutions

    • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

  • Structural approaches:

    • Cryo-electron microscopy of purified complexes

    • X-ray crystallography of co-purified partners

    • Solid-state NMR of reconstituted membrane complexes

  • Data validation:

    • Confirm interactions using multiple orthogonal techniques

    • Perform mutagenesis of predicted interaction sites

    • Assess functional relevance through phenotypic analysis of interaction-deficient mutants

Since O. anthropi shows evidence of recombination and has a clonal population structure , consider investigating whether interaction partners co-evolve with CrcB variants from different lineages.

How should researchers interpret conflicting molecular identification results when working with O. anthropi?

O. anthropi can be misidentified using traditional methods, particularly being confused with Brucella spp. . When faced with conflicting results:

  • Resolution approach for contradictory identification:

    • Prioritize molecular methods over phenotypic tests

    • Perform 16S rRNA gene sequencing and compare to reference databases

    • Conduct maximum likelihood phylogenetic analysis against reference sequences

    • Implement MLST using the established 7-gene scheme for O. anthropi

  • Understanding the basis for misidentification:

    • O. anthropi and Brucella share phenotypic characteristics (gram-negative morphology, non-fermenting metabolism, positive catalase and urease tests)

    • Similar molecules exist in their outer membranes, including phosphatidylcholine and LPS components

    • Differences exist in their lipid A core structures, which can be used for differentiation

  • Quality control measures:

    • Include reference strains in all analyses (O. anthropi ATCC49188T is recommended)

    • Perform parallel testing with multiple methods

    • Consider whole genome sequencing for definitive identification

  • Implications for recombinant protein research:

    • Verify the source organism before cloning genes

    • Sequence the target gene to confirm identity

    • Consider synthetic gene synthesis based on verified sequences

What statistical approaches are most appropriate for analyzing genetic variation in CrcB homologs across O. anthropi populations?

When analyzing genetic variation in CrcB homologs:

  • Population genetics metrics:

    • Calculate nucleotide diversity (π) and haplotype diversity (Hd)

    • Determine the standardized Index of Association (sIA) to assess linkage disequilibrium

    • Perform neutrality tests (Tajima's D, Fu's Fs) to detect selection

  • Phylogenetic approaches:

    • Construct maximum likelihood trees with appropriate substitution models

    • Perform split decomposition analysis to detect recombination events

    • Use the NeighborNet algorithm to visualize network-like evolutionary relationships

  • Recombination analysis:

    • Apply methods for detecting recombination breakpoints (RDP, MaxChi, Bootscan)

    • Calculate the ratio of recombination to mutation (r/m) rates

    • Identify potential donor sequences for recombination events

  • Structure-function correlation:

    • Map sequence variations to predicted structural domains

    • Conduct coevolutionary analysis to identify functionally linked residues

    • Correlate genetic variants with habitat (clinical vs environmental) to identify adaptive changes

For O. anthropi, these approaches should consider the epidemic population structure with evidence of both clonal expansion and recombination , which may affect interpretation of genetic diversity patterns.

How can researchers effectively integrate multi-omics data to understand the functional context of CrcB homolog in O. anthropi?

Integrating multiple omics datasets provides comprehensive insights:

  • Data types and collection strategies:

    • Genomics: Whole genome sequencing of multiple strains to place crcB in genomic context

    • Transcriptomics: RNA-seq under various conditions (fluoride exposure, pH stress, host interaction)

    • Proteomics: Quantitative proteomics to measure expression levels and post-translational modifications

    • Metabolomics: Assess metabolic changes associated with crcB expression or deletion

  • Integration approaches:

    • Multi-layer network analysis to identify functional modules

    • Correlation analysis across omics layers

    • Causal network inference to predict regulatory relationships

    • Machine learning approaches to identify predictive signatures

  • Visualization and interpretation:

    • Integrated pathway mapping using tools like PathVisio or KEGG

    • Multi-omics data browsers to explore relationships

    • Circular visualization of genomic context and expression data

  • Functional validation:

    • Target validation of predicted functional partners through knockout studies

    • Confirmation of regulatory relationships through promoter analysis

    • Testing of predicted metabolic impacts through targeted metabolomics

This approach is particularly valuable for O. anthropi given its complex population structure with evidence of both clonal expansion and recombination , which may result in lineage-specific functional networks.

What are the best practices for establishing academic-community partnerships when researching opportunistic pathogens like O. anthropi?

Based on community-engaged research principles:

  • Partnership formation and maintenance:

    • Establish clear goals and expectations before research begins

    • Develop a memorandum of understanding documenting terms of agreement

    • Engage in respectful negotiation throughout the research process

    • Recognize different expertise and assets brought by each partner

  • Ethical considerations for O. anthropi research:

    • Address potential risks of studying an opportunistic pathogen

    • Develop biosafety protocols appropriate for community settings

    • Consider implications of findings for healthcare facilities and vulnerable populations

  • Research agenda development:

    • Ensure adequate dialog to reflect community health priorities

    • Assess academic researcher skills and interests relative to community needs

    • Evaluate funding availability for particular research directions

    • Consider alternative projects if funding for top priorities is unavailable

  • Research design and implementation:

    • Incorporate both academic expertise in methodology and community knowledge of local contexts

    • Allow community partners to reject or modify projects that may expose vulnerabilities

    • Negotiate modifications to proposals to better align with community priorities

The community-based participatory research (CBPR) model provides a framework where community partners have equal authority and responsibility with academic researchers , which is particularly important when studying opportunistic pathogens that may impact public health.

How can researchers effectively communicate findings about O. anthropi CrcB homolog to diverse stakeholders?

Effective communication strategies include:

  • Scientific community communication:

    • Peer-reviewed publications with comprehensive methodologies

    • Conference presentations highlighting key findings

    • Data repositories for sharing sequence and structural information

    • Open access publication when possible to maximize accessibility

  • Healthcare stakeholder communication:

    • Translational summaries focusing on clinical relevance

    • Briefing documents explaining implications for infection control

    • Workshops for healthcare providers on identification and management

  • Public health and community communication:

    • Lay summaries avoiding technical jargon

    • Visual representations of key concepts

    • Community forums for discussing implications

    • Transparent discussion of limitations and uncertainties

  • Policy and regulatory communication:

    • Evidence summaries with clear policy implications

    • Cost-benefit analyses of implementation strategies

    • Guidance documents for laboratory identification

When communicating about O. anthropi, emphasize its dual nature as both an environmental organism and an opportunistic pathogen with a human-associated lineage , while avoiding creating undue alarm about a relatively uncommon pathogen.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.