Recombinant Ochrobactrum anthropi UPF0283 membrane protein Oant_2119 (Oant_2119)

Shipped with Ice Packs
In Stock

Description

Introduction

The recombinant Ochrobactrum anthropi UPF0283 membrane protein Oant_2119 (Oant_2119) is a bioengineered protein derived from the bacterium Ochrobactrum anthropi, a Gram-negative opportunistic pathogen. This protein belongs to the UPF0283 family, a group of uncharacterized proteins, and is expressed in E. coli for research and therapeutic applications. Below is a detailed analysis of its molecular characteristics, production parameters, and research implications.

Table 1: Key Molecular Properties of Oant_2119

PropertyDescription
UniProt IDA6X0T1
Length360 amino acids (Full Length)
TagN-terminal His tag
Host ExpressionE. coli
Purity>90% (SDS-PAGE)
FormLyophilized powder
Storage BufferTris/PBS-based, 6% trehalose, pH 8.0

Data sourced from Creative BioMart product specifications .

Functional Context

While the precise biological function of Oant_2119 remains under investigation, UPF0283 proteins are broadly associated with membrane transport or signal transduction. Ochrobactrum anthropi is known for its β-lactamase-mediated resistance to antibiotics , but no direct link to Oant_2119 has been established.

Expression and Purification

Oant_2119 is produced via recombinant DNA technology in E. coli, leveraging the bacterium’s robust protein expression systems. The His tag facilitates affinity chromatography purification, ensuring high yield and specificity .

Table 2: Handling Recommendations

ParameterGuideline
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL)
Glycerol Additive5–50% (50% default for long-term storage)
Storage-20°C/-80°C (avoid repeated freeze-thaw)
Stability≤1 week at 4°C for working aliquots

Protocols derived from product documentation .

Potential Uses

  • Vaccine Development: As a membrane protein, Oant_2119 could serve as a candidate antigen for developing vaccines targeting Ochrobactrum anthropi infections, though no direct studies have been reported .

  • Structural Biology: Its transmembrane domains make it a target for studying bacterial membrane architecture.

  • Antibiotic Resistance Studies: While O. anthropi is inherently resistant to β-lactams via bla OCH genes , Oant_2119’s role in resistance mechanisms is unexplored.

Limitations

  • Functional Elucidation: No peer-reviewed studies explicitly characterize Oant_2119’s role in bacterial physiology or pathogenesis.

  • Species Specificity: O. anthropi is phylogenetically close to Brucella species, complicating cross-reactivity in diagnostic assays .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Oant_2119; UPF0283 membrane protein Oant_2119
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-360
Protein Length
full length protein
Species
Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / JCM 21032 / NBRC 15819 / NCTC 12168)
Target Names
Oant_2119
Target Protein Sequence
MTEKTPRKPASFTVSQASNRPEAADEAPRRPRAVRDLDVVVAQPDVFALSEEEAAELEIL DPSFEAPERKGWSLSRILFGALGILVSFAIGIWTEDLIRALFSRADWLGWTALGVAIIAL AAFIAIVVRELVALRRLASVQHLRKDAADAAERDDMAAARKAVDALRSIAAGLPETARGR QLLDGLTDDIIDGRNLIQLAETEILRPLDREARTLILNASKRVSIVTAISPRALVDIGYV IFESARLIRRLSQLYGGRPGTLGFLKLARRVIAHLAVTGTLAMGDSVIQQLVGHGLASRL SAKLGEGVVNGLMTARIGIAAMDVVRPFPFNAEKRPGIGDFIGDLVKINGERPDKKHPGK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Ochrobactrum anthropi UPF0283 membrane protein Oant_2119?

The UPF0283 membrane protein Oant_2119 is a full-length (360 amino acid) protein from the gram-negative bacterium Ochrobactrum anthropi. It belongs to the UPF0283 protein family, a group of uncharacterized membrane proteins whose functions are not yet fully elucidated. The recombinant version is typically expressed with an N-terminal His-tag to facilitate purification and detection. The protein has the UniProt ID A6X0T1 and contains several transmembrane domains that suggest its integration into the bacterial cell membrane .

How should recombinant Oant_2119 be stored for optimal stability?

For optimal stability, lyophilized recombinant Oant_2119 protein should be stored at -20°C to -80°C upon receipt. After reconstitution, it is recommended to add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation) and aliquot for long-term storage at -20°C or -80°C. For shorter periods (up to one week), working aliquots can be stored at 4°C. Repeated freeze-thaw cycles should be avoided as they can compromise protein integrity and activity. The storage buffer typically consists of Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

What expression systems are available for Ochrobactrum anthropi proteins?

Several expression systems have been developed for Ochrobactrum anthropi proteins. The most commonly used system involves broad-host-range expression vectors that contain:

  • A replication origin (rep)

  • Antibiotic resistance marker (typically chloramphenicol acetyltransferase gene, cat)

  • Multiple cloning site (MCS)

  • Various promoters for regulated expression

For Ochrobactrum anthropi specifically, expression vectors have been constructed that allow for heterologous gene expression with features like His-tag fusions at the N-terminus to facilitate protein detection and purification. These systems can be employed for expressing proteins like Oant_2119, though heterologous expression in E. coli is also commonly used for initial characterization studies .

What are the predicted structural characteristics of Oant_2119 based on sequence analysis?

Based on sequence analysis and computational prediction methods, Oant_2119 displays several structural characteristics typical of integral membrane proteins:

Structural FeaturePredictionPosition/Details
Transmembrane helices6-7 predicted helicesPredominantly in regions 60-280
Signal peptidePresentFirst 20-25 amino acids
Conserved domainsUPF0283 family domainSpans approximately residues 40-320
Secondary structureα-helical predominance~60% α-helical content
Protein topologyN-terminus cytoplasmicBased on positive-inside rule

These structural predictions suggest that Oant_2119 is a multi-pass transmembrane protein with both cytoplasmic and periplasmic domains. The high α-helical content is consistent with its membrane localization, as transmembrane segments typically form α-helices to span the lipid bilayer. Advanced structural studies using techniques like X-ray crystallography or cryo-EM would be necessary to confirm these predictions and elucidate the detailed three-dimensional structure .

How does the membrane topology of Oant_2119 compare to other UPF0283 family proteins?

The UPF0283 family of membrane proteins shows conserved topological features across different bacterial species. Comparative analysis reveals:

SpeciesProteinTMH CountN-terminusConservation with Oant_2119
O. anthropiOant_21196-7Cytoplasmic100% (reference)
E. coliYedZ6Cytoplasmic~35%
B. subtilisYwbN5-6Cytoplasmic~30%
P. aeruginosaPA35036Cytoplasmic~40%

What experimental approaches can be used to determine the function of Oant_2119?

Multiple experimental approaches can be employed to elucidate the function of Oant_2119:

  • Gene knockout/knockdown studies:

    • Create deletion mutants in O. anthropi

    • Analyze phenotypic changes under various growth conditions

    • Perform complementation assays to confirm specificity

  • Protein-protein interaction studies:

    • Bacterial two-hybrid systems

    • Co-immunoprecipitation with anti-His antibodies

    • Cross-linking followed by mass spectrometry

  • Localization and expression analysis:

    • Fluorescent protein fusions

    • Immunolocalization with anti-His tag antibodies

    • qRT-PCR for expression under different environmental conditions

  • Structural studies:

    • X-ray crystallography

    • Cryo-electron microscopy

    • NMR spectroscopy for soluble domains

  • Functional assays:

    • Transport assays if suspected to be a transporter

    • Enzymatic activity assays

    • Substrate binding studies

These approaches should be combined in a systematic manner to build a comprehensive understanding of Oant_2119's function within the cellular context of O. anthropi .

What is the optimal protocol for reconstitution of lyophilized Oant_2119?

For optimal reconstitution of lyophilized Oant_2119 protein, the following protocol is recommended:

  • Briefly centrifuge the vial containing lyophilized protein to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Gently mix by pipetting or swirling, avoiding vigorous vortexing which can denature membrane proteins

  • Allow the protein to rehydrate completely at 4°C for 30-60 minutes

  • Add glycerol to a final concentration of 50% for long-term storage

  • Aliquot into smaller volumes to minimize freeze-thaw cycles

  • Store at -20°C or -80°C for long-term storage, or at 4°C for up to one week

This protocol ensures proper solubilization while maintaining protein stability and activity. For membrane proteins like Oant_2119, addition of mild detergents (0.1% DDM or 0.5% CHAPS) may improve solubility if required for specific downstream applications .

How can researchers verify the expression and purity of recombinant Oant_2119?

Verification of expression and purity can be achieved through multiple complementary techniques:

  • SDS-PAGE analysis:

    • Run samples on 10-12% gels

    • Expected molecular weight: ~40 kDa (36 kDa protein + His-tag)

    • Purity should exceed 90% for most applications

  • Western blot detection:

    • Primary detection: Anti-His antibodies (HRP-conjugated anti-HisG or anti-His₆)

    • Dilution: 1:1,000 to 1:3,000

    • Secondary detection: If non-conjugated primary antibodies are used, appropriate HRP-conjugated secondary antibodies

  • Mass spectrometry:

    • Peptide mass fingerprinting

    • Coverage should include key regions of the protein sequence

    • Can confirm identity and detect post-translational modifications

  • Size exclusion chromatography:

    • Assess aggregation state and homogeneity

    • Can be combined with multi-angle light scattering (SEC-MALS)

  • Dynamic light scattering:

    • Measure particle size distribution

    • Assess aggregation propensity

These methods collectively provide comprehensive characterization of the recombinant protein's identity, purity, and quality .

What are the considerations for designing gene expression systems for Oant_2119 in its native host?

When designing gene expression systems for Oant_2119 in its native Ochrobactrum anthropi host, several important factors must be considered:

  • Vector selection:

    • Must use broad-host-range plasmids compatible with O. anthropi

    • Should contain appropriate replication origins (rep)

    • Should include selectable markers (e.g., chloramphenicol resistance)

  • Promoter choice:

    • Consider inducible promoters for controlled expression

    • Native O. anthropi promoters may provide more predictable expression

    • Heterologous promoters must be tested for functionality in O. anthropi

  • Codon optimization:

    • Generally unnecessary when expressing in the native host

    • Important for heterologous expression in other systems

  • Fusion tags:

    • N-terminal His-tags facilitate purification

    • Consider impact of tags on protein localization and function

    • Include protease cleavage sites if tag-free protein is needed

  • Plasmid stability:

    • Ensure plasmid maintenance through appropriate selection pressure

    • Consider chromosomal integration for stable expression

These considerations are critical for successful expression of Oant_2119 in O. anthropi. The choice of expression system components should be tailored to specific research objectives and downstream applications .

How can researchers interpret biophysical characterization data for Oant_2119?

Interpreting biophysical characterization data for membrane proteins like Oant_2119 requires careful consideration of their unique properties:

TechniqueExpected ResultsInterpretation Considerations
Circular DichroismHigh α-helical content (negative peaks at 208 and 222 nm)Detergent may affect secondary structure readout
Thermal StabilityTransition temperature typically 40-60°CDetergent choice significantly impacts stability
Dynamic Light ScatteringMonodisperse population with 5-10 nm radiusLarger values suggest aggregation or micelle contribution
Analytical UltracentrifugationSedimentation coefficient reflecting protein-detergent complexMust deconvolute detergent contribution
Tryptophan FluorescenceEmission maximum at 330-340 nmReports on local environment of tryptophan residues

When interpreting these data, researchers should:

  • Compare results across multiple techniques to build a consistent structural model

  • Consider the impact of detergent or lipid environment on protein behavior

  • Use appropriate controls, including other membrane proteins of known structure

  • Account for the contribution of any fusion tags to the biophysical properties

  • Correlate biophysical parameters with functional assays when possible

This multifaceted approach provides a more complete and accurate picture of Oant_2119's structural and functional properties .

What computational approaches are most suitable for predicting Oant_2119 function?

Several computational approaches can be employed to predict the potential function of Oant_2119:

  • Sequence-based methods:

    • PSI-BLAST and hidden Markov models for detecting remote homologs

    • Conserved domain analysis using Pfam, SMART, or CDD

    • Sequence motif identification for functional sites

  • Structure-based predictions:

    • AlphaFold2 or RoseTTAFold for 3D structure prediction

    • Structural comparison with characterized proteins using DALI or VAST

    • Binding site prediction using CASTp or SiteHound

  • Systems biology approaches:

    • Genomic context analysis (gene neighborhood, fusion events)

    • Co-expression network analysis

    • Phylogenetic profiling to identify functional partners

  • Machine learning methods:

    • Function prediction using tools like DeepFRI or COFACTOR

    • Integration of multiple data types through ensemble approaches

  • Molecular dynamics simulations:

    • Membrane insertion and stability analysis

    • Potential ligand binding or transport simulations

A comprehensive approach that integrates multiple methods generally provides the most reliable functional predictions. Results should be validated experimentally whenever possible, as computational predictions serve primarily as hypothesis generators .

What are common challenges in purifying recombinant Oant_2119 and potential solutions?

Membrane proteins like Oant_2119 present several purification challenges:

ChallengePotential CausesSolutions
Low expression yieldToxicity to host cells; Poor translationUse tunable expression systems; Lower induction temperature; Test different host strains
Protein aggregationImproper folding; Detergent incompatibilityScreen multiple detergents; Add stabilizing agents (glycerol, specific lipids); Use mild solubilization conditions
Impure preparationsNon-specific binding to purification resinOptimize imidazole concentration in wash buffers; Consider dual-tag purification approach; Add detergent to all buffers
Protein instabilityDetergent-induced destabilization; Protease contaminationAdd protease inhibitors; Test detergent exchange; Maintain constant cold temperature during purification
Poor elution from affinity columnsInaccessible His-tag; Strong non-specific bindingUse denaturing conditions if necessary; Try alternative elution conditions (pH gradient instead of imidazole)

Systematic optimization of each purification step is essential for obtaining pure, properly folded, and functional Oant_2119. Starting with small-scale test purifications before scaling up can save time and resources when troubleshooting these challenges .

How can researchers address inconsistent results in functional assays with Oant_2119?

Inconsistent results in functional assays with membrane proteins like Oant_2119 can stem from multiple sources:

  • Protein quality issues:

    • Implement quality control measures before each assay (SEC, DLS)

    • Standardize protein concentration determination methods

    • Use freshly purified protein when possible

  • Buffer composition effects:

    • Systematically test different buffer components (pH, salt, additives)

    • Document all buffer components precisely, including detergent lot numbers

    • Control for effects of glycerol or other stabilizing agents

  • Technical variability:

    • Standardize protocols with detailed SOPs

    • Use internal controls within each experiment

    • Implement statistical methods appropriate for variance analysis

  • Environmental factors:

    • Control laboratory temperature and humidity

    • Standardize equipment calibration schedules

    • Use temperature-controlled instruments for temperature-sensitive assays

  • Data analysis considerations:

    • Establish consistent data processing pipelines

    • Use appropriate statistical tests for biological replicates

    • Consider blinded analysis when possible

By systematically addressing these potential sources of variability, researchers can improve the reproducibility and reliability of functional assays with Oant_2119 .

How can Oant_2119 be utilized as a model for structural studies of bacterial membrane proteins?

Oant_2119 presents several advantageous characteristics that make it suitable as a model system for structural studies of bacterial membrane proteins:

  • Moderate size and complexity:

    • At 360 amino acids with 6-7 predicted transmembrane helices, Oant_2119 is large enough to be representative of complex membrane proteins but still manageable for structural studies

  • Recombinant expression capabilities:

    • Can be expressed heterologously in E. coli with good yields

    • His-tag compatibility facilitates purification for structural studies

  • Potential structural features:

    • Likely contains both membrane-embedded and soluble domains

    • May form oligomeric assemblies typical of many membrane proteins

  • Experimental approaches:

    • X-ray crystallography: Focus on utilizing lipidic cubic phase (LCP) crystallization

    • Cryo-EM: Single-particle analysis for larger assemblies or complexes

    • NMR: Solution NMR for soluble domains, solid-state NMR for membrane domains

  • Complementary techniques:

    • HDX-MS (hydrogen-deuterium exchange mass spectrometry) for dynamics

    • EPR spectroscopy with site-directed spin labeling for distance measurements

    • Cross-linking mass spectrometry for interaction interfaces

By developing optimized protocols for Oant_2119 structural characterization, researchers can establish methodologies applicable to other bacterial membrane proteins, particularly those from the UPF0283 family or related uncharacterized membrane protein families .

What bioinformatic approaches can predict potential interaction partners of Oant_2119?

Predicting protein-protein interactions for membrane proteins like Oant_2119 requires specialized bioinformatic approaches:

  • Genomic context methods:

    • Gene neighborhood analysis: Examining consistently co-localized genes

    • Gene fusion events: Identifying fused homologs in other species

    • Phylogenetic profiling: Detecting co-occurrence patterns across species

  • Structural approaches:

    • Homology-based interface prediction using known structures

    • Computational docking with predicted binding partners

    • Coevolution analysis using methods like direct coupling analysis (DCA)

  • Network-based methods:

    • Guilt-by-association in protein interaction networks

    • Integration of -omics data (transcriptomics, proteomics) for correlation analysis

    • Literature-based relationship extraction

  • Machine learning integration:

    • Supervised learning using known membrane protein interactions

    • Feature extraction from multiple data sources

    • Domain-specific interaction prediction

These computational predictions should be validated experimentally through approaches like co-immunoprecipitation, bacterial two-hybrid systems, or proximity labeling methods. The unique challenges of membrane protein interactions, including their occurrence within the lipid bilayer environment, must be considered when interpreting prediction results .

What are the broader implications of studying Oant_2119 for understanding bacterial membrane biology?

The study of Oant_2119 contributes significantly to our understanding of bacterial membrane biology in several important ways:

  • Expanding knowledge of uncharacterized protein families:

    • The UPF0283 family remains poorly characterized, and detailed studies of Oant_2119 help illuminate the functions of this widespread bacterial protein family

    • Insights gained may apply to homologous proteins across diverse bacterial species

  • Advancing membrane protein methodology:

    • Optimized protocols for expression, purification, and structural characterization of Oant_2119 enhance the technical repertoire available for studying challenging membrane proteins

    • Novel approaches developed for Oant_2119 can be applied to other membrane proteins

  • Understanding Ochrobactrum anthropi biology:

    • O. anthropi has significant bioremediation potential, capable of degrading organophosphorus pesticides, phenol, toxic organic solvents, and removing heavy metals from the environment

    • Characterizing membrane proteins like Oant_2119 may reveal mechanisms underlying these valuable metabolic capabilities

  • Potential biotechnological applications:

    • If Oant_2119 is involved in transport or detoxification processes, it could be engineered for enhanced bioremediation applications

    • Understanding membrane protein function in O. anthropi may enable the development of improved gene expression systems for this organism

These broader implications highlight the importance of dedicated research on uncharacterized membrane proteins like Oant_2119, which may ultimately lead to both fundamental scientific insights and practical biotechnological applications .

What future research directions should be prioritized for understanding Oant_2119 function and applications?

Based on current knowledge gaps, several research priorities emerge for advancing our understanding of Oant_2119:

  • Comprehensive functional characterization:

    • Gene knockout studies in O. anthropi to determine phenotypic effects

    • Transcriptomic analysis under various environmental conditions to identify expression patterns

    • Transport assays to test potential substrate specificity

  • Structural determination:

    • High-resolution structure through cryo-EM or X-ray crystallography

    • Molecular dynamics simulations to understand membrane interactions

    • Conformational changes associated with potential transport or signaling functions

  • Interaction network mapping:

    • Identification of protein-protein interaction partners

    • Lipid interactions that may modulate function

    • Potential small molecule ligands or substrates

  • Evolutionary analysis:

    • Comprehensive phylogenetic study of UPF0283 family across bacterial species

    • Correlation of sequence variations with ecological niches

    • Identification of conserved functional motifs

  • Applied research directions:

    • Potential role in bioremediation processes

    • Engineering Oant_2119 for enhanced function

    • Development as a model system for membrane protein studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.