Recombinant Ochrotomys nuttalli NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Description

Functional Role in Mitochondrial Energetics

MT-ND3 is a core subunit of complex I (NADH-ubiquinone oxidoreductase), the largest enzyme in the electron transport chain. Its primary functions include:

  • Electron Transfer: Facilitates the transfer of electrons from NADH to ubiquinone, contributing to proton pumping across the mitochondrial inner membrane .

  • Structural Stability: Forms part of the transmembrane domain, anchoring the enzyme in the lipid bilayer and enabling interactions with other subunits like ND1, ND2, ND4, ND4L, ND5, and ND6 .

In Ochrotomys nuttalli, MT-ND3’s sequence and structural organization align with its human counterpart, reinforcing its evolutionary conservation. Mutations in MT-ND3, such as m.10197G > C or m.10191T > C, disrupt complex I assembly and activity, leading to ATP deficiency and mitochondrial disorders .

Complex I Deficiency and Associated Disorders

MT-ND3 mutations are linked to Leigh syndrome, Leber’s hereditary optic neuropathy (LHON), and mitochondrial encephalomyopathy, lactic acidosis, and stroke-like episodes (MELAS) . These conditions arise from impaired electron transport, increased lactate levels, and oxidative stress.

Mechanistic Insights from Patient Studies

In a recent case study, a novel m.10197G > C variant in MT-ND3 caused:

  • Reduced Protein Levels: ~50% decrease in MT-ND3 expression.

  • Complex I Deficiency: Loss of enzyme activity and incomplete assembly.

  • ATP Deficit: Significantly reduced ATP synthesis, exacerbating cellular energy failure .

Experimental Models and Assays

The recombinant MT-ND3 protein serves as a critical tool for:

  • Structural Studies: Analyzing subunit interactions and complex I assembly.

  • Enzymatic Assays: Measuring NADH-ubiquinone reductase activity in vitro.

  • SDS-PAGE Validation: Confirming protein purity and size (13 kDa) .

Allotopic Expression for Therapeutic Rescue

Codon-optimized nuclear expression of MT-ND3 has shown promise in rescuing complex I deficiencies:

  • Strategy: Mitochondrial targeting sequences are appended to nuclear-expressed MT-ND3, allowing import into mitochondria.

  • Outcomes: Partial restoration of complex I activity and ATP production in patient-derived cells .

Comparative Analysis of MT-ND3 Across Species

FeatureOchrotomys nuttalliHuman
Gene LocationMitochondrial genome (homologous to human)Mitochondrial genome (bases 10,059–10,404)
Protein Length115 amino acids115 amino acids
Key FunctionTransmembrane domain, electron transferTransmembrane domain, electron transfer
Disease AssociationsComplex I deficiency (experimental models)Leigh syndrome, MELAS, LHON

Limitations of Current Approaches

  • Expression Challenges: Bacterial production may not fully replicate mitochondrial folding or post-translational modifications.

  • Therapeutic Delivery: Efficient mitochondrial import of nuclear-encoded MT-ND3 remains technically demanding .

Emerging Strategies

  • Gene Therapy: Viral vectors for targeted delivery of codon-optimized MT-ND3 to affected tissues.

  • Protein Replacement: Recombinant MT-ND3 as a supplement in cellular models of complex I deficiency.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We suggest centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Ochrotomys nuttalli (Golden mouse) (Peromyscus nuttalli)
Target Names
Target Protein Sequence
MNMLLVIAVNTILSLILITVAFWLPQLNIYTEKANPYECGFDPMSSARLPFSMKFFLVAI TFLLFDLEIALLLPIPWAIQTPHINMVLPTALILLTILALGLAYEWLQKGLEWTE
Uniprot No.

Target Background

Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. Essential for the catalytic activity of complex I.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND3 and what is its function in Ochrotomys nuttalli?

MT-ND3 (NADH-ubiquinone oxidoreductase chain 3) is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). This protein plays a critical role in the electron transfer from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor for the enzyme. The protein functions as part of the minimal assembly required for catalysis within Complex I . In Ochrotomys nuttalli (golden mouse), as in other mammals, MT-ND3 participates in mitochondrial energy production through oxidative phosphorylation. The golden mouse is a small rodent found primarily in the southeastern United States, with a total length of 127-180 mm and weight of 20-26 grams .

How is recombinant Ochrotomys nuttalli MT-ND3 typically produced for research applications?

Recombinant Ochrotomys nuttalli MT-ND3 is typically produced using an E. coli expression system. The full-length protein (amino acids 1-115) is expressed with an N-terminal His-tag to facilitate purification . The production process generally involves:

  • Cloning the MT-ND3 gene into an appropriate expression vector

  • Transforming E. coli with the recombinant plasmid

  • Inducing protein expression under optimized conditions

  • Cell lysis and protein extraction

  • Purification using affinity chromatography (leveraging the His-tag)

  • Quality control including SDS-PAGE analysis to ensure purity (typically >90%)

  • Lyophilization for stable long-term storage

The recombinant protein is then supplied as a lyophilized powder in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 .

What are the optimal storage conditions for recombinant Ochrotomys nuttalli MT-ND3?

For optimal stability and activity retention of recombinant Ochrotomys nuttalli MT-ND3, the following storage conditions are recommended:

  • Long-term storage: Store the lyophilized protein at -20°C to -80°C

  • Working aliquots: Store at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as they can compromise protein integrity

  • For reconstituted protein, storage in a buffer containing 50% glycerol is recommended

The presence of trehalose (6%) in the storage buffer enhances protein stability during the freeze-thaw process by preventing protein denaturation and aggregation. This cryoprotectant is particularly important for maintaining the native conformation of membrane proteins like MT-ND3 .

What is the recommended reconstitution protocol for lyophilized Ochrotomys nuttalli MT-ND3?

The recommended reconstitution protocol includes:

  • Briefly centrifuge the vial prior to opening to ensure all content is at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is the default recommended concentration)

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles

  • Store aliquots at -20°C or -80°C for long-term storage

This reconstitution approach ensures optimal protein stability while minimizing potential degradation. The addition of glycerol prevents ice crystal formation during freezing, which could otherwise damage the protein structure .

How can Ochrotomys nuttalli MT-ND3 be used in comparative mitochondrial studies across rodent species?

Recombinant Ochrotomys nuttalli MT-ND3 can serve as a valuable reference in comparative studies of mitochondrial function across rodent species. Researchers can:

  • Compare MT-ND3 sequence homology between Ochrotomys nuttalli and other rodents to elucidate evolutionary relationships

  • Conduct functional assays to assess differences in Complex I activity across species

  • Perform binding studies to investigate species-specific protein-protein interactions within the respiratory chain

  • Develop antibodies against conserved epitopes for cross-species detection of MT-ND3

  • Analyze structural differences that might correlate with metabolic adaptations in different rodent species

These comparative approaches are particularly valuable when studying species with different ecological niches or metabolic demands. Ochrotomys nuttalli, with its specific habitat requirements and behaviors, may exhibit adaptations in its mitochondrial proteins that reflect its evolutionary history and ecological specialization .

What analytical techniques are most effective for studying MT-ND3 protein interactions with other components of Complex I?

Several analytical techniques are particularly effective for studying MT-ND3 interactions:

  • Co-immunoprecipitation (Co-IP): Using antibodies against the His-tag or MT-ND3 itself to pull down protein complexes

  • Blue Native PAGE: For analyzing intact protein complexes while preserving native protein-protein interactions

  • Crosslinking Mass Spectrometry: To identify specific interaction sites between MT-ND3 and other Complex I components

  • Surface Plasmon Resonance (SPR): For measuring binding kinetics and affinities

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): To map interaction interfaces and conformational changes

  • Cryo-Electron Microscopy: For structural analysis of MT-ND3 within the assembled Complex I

When working with recombinant Ochrotomys nuttalli MT-ND3, researchers should be mindful that the His-tag might influence protein interactions. Control experiments comparing tagged and untagged versions can help validate findings .

How can Ochrotomys nuttalli MT-ND3 contribute to understanding mitochondrial disease mutations?

Studies involving Ochrotomys nuttalli MT-ND3 can provide valuable insights into mitochondrial diseases through:

  • Comparative sequence analysis with human MT-ND3 to identify conserved regions susceptible to pathogenic mutations

  • In vitro mutagenesis to recreate disease-associated mutations and assess their impact on protein function

  • Structure-function studies to elucidate how specific mutations alter Complex I assembly or activity

  • Development of cellular models expressing mutant MT-ND3 variants

Research on MT-ND3 mutations, such as m.10197G>A, has revealed associations with conditions like Leigh syndrome (LS) and Leber hereditary optic neuropathy (LHON). In a comprehensive analysis of 85 individuals with the m.10197G>A mutation, 55.3% presented with LS or LS-involved overlap syndrome, while 28.2% presented with LHON or LHON-involved overlap syndrome. The median age at onset for LS/LS+ was significantly younger than for LHON/LHON+ [3.0 years vs. 13.5 years, P = 0.001] .

What is the correlation between MT-ND3 mutations, mutation load, and clinical presentation?

Research has identified significant correlations between MT-ND3 mutations, mutation load, and clinical outcomes:

  • A negative linear correlation exists between mutation load and age of onset in patients with LS/LS+ (R² = 0.592, P < 0.001)

  • Patients with higher mutation loads are more likely to present with LHON/LHON+ than with LS/LS+ [OR = 1.14 (95% CI: 1.03-1.26), P = 0.011]

  • Older age at onset increases the probability of LHON/LHON+ presentation [OR = 1.46 (95% CI: 1.12-1.91), P = 0.005]

  • Patients with LS/LS+ have a considerably higher probability of stable or worsening outcomes compared to patients with LHON/LHON+ (93.8% vs. 33.3%, P = 0.006)

These findings highlight the complex relationship between genotype, mutation heteroplasmy, and clinical phenotype in mitochondrial diseases involving MT-ND3, offering potential avenues for developing models using recombinant MT-ND3 proteins .

How can structural studies of Ochrotomys nuttalli MT-ND3 contribute to understanding Complex I assembly and function?

Structural studies of Ochrotomys nuttalli MT-ND3 can provide critical insights into Complex I biology through:

  • Determination of transmembrane topology and identification of functionally important domains

  • Mapping of interaction sites with other Complex I subunits

  • Elucidation of conformational changes during electron transfer

  • Comparison with MT-ND3 structures from other species to identify conserved structural elements

Such studies can leverage the recombinant protein's His-tag for purification and detection while employing techniques such as:

  • Hydrogen-deuterium exchange mass spectrometry

  • Site-directed spin labeling combined with electron paramagnetic resonance

  • Cryo-electron microscopy of reconstituted complexes

  • Computational modeling and molecular dynamics simulations

These approaches can reveal how MT-ND3's structure contributes to the proton-pumping mechanism of Complex I and potentially identify novel targets for therapeutic intervention in mitochondrial disorders .

What are the methodological considerations for using recombinant MT-ND3 in functional reconstitution experiments?

When using recombinant Ochrotomys nuttalli MT-ND3 for functional reconstitution experiments, researchers should consider:

  • Protein solubilization and stability:

    • Select appropriate detergents that maintain protein structure and function

    • Optimize lipid-to-protein ratios when reconstituting into liposomes

    • Monitor protein stability using circular dichroism or fluorescence spectroscopy

  • Reconstitution strategies:

    • Direct incorporation into liposomes or nanodiscs

    • Co-reconstitution with other Complex I subunits

    • Step-wise assembly of partial complexes

  • Functional assays:

    • NADH oxidation measurements

    • Membrane potential monitoring using fluorescent probes

    • Hydrogen peroxide production as a measure of electron leakage

    • Proton pumping assays using pH-sensitive dyes

  • Quality control:

    • Proteoliposome size and homogeneity assessment

    • Protein orientation verification

    • Activity comparison with native Complex I preparations

The recombinant protein's high purity (>90% as determined by SDS-PAGE) makes it suitable for such applications, though researchers should validate that the His-tag does not interfere with the protein's functional properties .

How does Ochrotomys nuttalli MT-ND3 compare with MT-ND3 from other mammalian species?

Comparative analysis of Ochrotomys nuttalli MT-ND3 with orthologs from other mammalian species can reveal:

  • Conserved functional domains critical for Complex I activity

  • Species-specific adaptations potentially related to metabolic requirements

  • Evolutionary patterns reflecting phylogenetic relationships

  • Differential selection pressures across protein regions

Such analyses typically employ multiple sequence alignments and calculation of conservation scores for each amino acid position. Since MT-ND3, along with ND4L and ND4, evolves at consistent rates and is inherited as a single locus without recombination, genetic distances calculated from these combined sequences can provide robust phylogenetic information .

The golden mouse (Ochrotomys nuttalli) represents an interesting comparative model due to its specific ecological niche and behaviors. This species constructs arboreal structures and exhibits different social behaviors compared to other mice, which might correlate with metabolic adaptations reflected in mitochondrial proteins .

What insights can MT-ND3 sequence analysis provide regarding the evolutionary history of Ochrotomys nuttalli?

MT-ND3 sequence analysis can offer significant insights into Ochrotomys nuttalli evolution:

  • Mitochondrial genes like MT-ND3 are valuable molecular markers for phylogenetic studies due to their maternal inheritance and absence of recombination

  • Comparison of synonymous vs. non-synonymous substitution rates can reveal selection pressures

  • Dating of divergence events can be estimated based on mutation rates

  • Geographic distribution of genetic variants can inform paleobiogeography

Ochrotomys nuttalli is distributed across the western half of Virginia, except for the most northerly counties, inhabiting various environments from densely forested lowlands to pine uplands on sandy soils. Subspecies such as O. n. aureolus and O. n. nuttalli show phenotypic differences that might be reflected in their mitochondrial genomes .

What are the best approaches for studying interactions between recombinant MT-ND3 and pharmacological agents?

For studying interactions between recombinant Ochrotomys nuttalli MT-ND3 and pharmacological agents, researchers should consider:

  • In vitro binding assays:

    • Isothermal titration calorimetry (ITC) to measure binding thermodynamics

    • Microscale thermophoresis (MST) for quantifying interactions in solution

    • Surface plasmon resonance (SPR) for real-time binding kinetics

  • Functional impact assessment:

    • Complex I activity assays in the presence of various compound concentrations

    • Respiratory chain function evaluation in reconstituted systems

    • ROS production measurements to assess electron leakage

  • Structural studies:

    • Hydrogen-deuterium exchange mass spectrometry to map binding sites

    • Nuclear magnetic resonance (NMR) for identifying structural changes upon binding

    • Computational docking and molecular dynamics simulations

  • Comparative pharmacology:

    • Cross-species comparison of drug effects on MT-ND3 function

    • Correlation of sequence variations with differential drug responses

These approaches can help identify compounds that modulate Complex I activity and potentially develop therapeutics for mitochondrial disorders involving MT-ND3 dysfunction .

How can researchers optimize antibody development against Ochrotomys nuttalli MT-ND3?

For optimal antibody development against Ochrotomys nuttalli MT-ND3, researchers should:

  • Epitope selection:

    • Identify antigenic regions using epitope prediction algorithms

    • Focus on regions with low sequence conservation across species for specificity

    • Target accessible regions (likely non-transmembrane domains)

    • Consider using synthetic peptides corresponding to hydrophilic regions

  • Immunization strategies:

    • Use the full-length recombinant protein for polyclonal antibody production

    • Employ predicted epitope peptides conjugated to carrier proteins for targeted responses

    • Consider multiple host species to increase success probability

  • Validation methods:

    • Confirm antibody specificity using Western blot with recombinant protein

    • Verify cross-reactivity with native protein in tissue samples

    • Test for specificity against closely related species

  • Application optimization:

    • Determine optimal conditions for Western blot, immunohistochemistry, and ELISA

    • Validate antibody performance in complex samples

    • Establish protocols for immunoprecipitation studies

Several MT-ND3 antibodies are commercially available for human and other species, which may display cross-reactivity with Ochrotomys nuttalli due to sequence conservation in certain regions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.