Recombinant Odontella sinensis Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Odontella sinensis Apocytochrome f (petA) is a recombinant protein derived from the marine centric diatom Odontella sinensis . Apocytochrome f is a component of the cytochrome b6f complex, which is essential for photosynthetic electron transfer in plants, algae, and cyanobacteria . The petA gene encodes cytochrome f, a protein that facilitates electron transport between Photosystem II and Photosystem I .

Protein Properties and Characteristics

Odontella sinensis Apocytochrome f (petA) possesses several key structural and functional characteristics :

  • Heme-binding domain Cytochrome f contains a conserved heme-binding domain with the consensus sequence YX(19)CANCH. This domain is crucial for the protein's redox activity .

  • Acidic domains Two highly acidic domains facilitate interaction with plastocyanin, a soluble electron carrier .

  • Membrane anchor domain A hydrophobic transmembrane domain anchors cytochrome f to the thylakoid membrane, enabling its integration into the cytochrome b6f complex .

  • Unique insertion Odontella sinensis cytochrome f features a unique insertion of 62 amino acid residues not found in other f-type cytochromes. This region is rich in valines, prolines, and phenylalanines, potentially influencing the protein's structure and function .

Applications and Research Significance

Recombinant Odontella sinensis Apocytochrome f (petA) is used in various research applications:

  • ELISA assays It can be employed as an antigen in Enzyme-Linked Immunosorbent Assays (ELISA) to detect and quantify antibodies against Odontella sinensis .

  • Photosynthetic research The protein is valuable in studies of photosynthetic electron transport, allowing researchers to investigate the structure, function, and regulation of the cytochrome b6f complex .

  • Biotechnological applications Recombinant cytochrome f can be utilized in developing bio-devices and systems that mimic or exploit photosynthetic electron transfer .

  • Phytoremediation As a component of photosynthetic machinery, petA can be used in the study of plants to remove pollutants from the environment .

Sequence Information

The Odontella sinensis Apocytochrome f (petA) protein has a specific amino acid sequence that includes the following features :

  • Full length protein It is a full-length protein.

  • Expression Region The region spans from amino acids 31 to 314.

  • AA Sequence YPVFAQQGYSNPRAANGKLACANCHLNQKAIEIEAPQAVLPNSVFEVTVKVPYDTTRQQVGANGKKADLNVGGIVILPKGFKLAAKNQIPAEVKAKNKGVFISPYSTEFDNILIVGPIAGKTHQELIFPVVSPDPEKDSDVKYLTYPLYAGGNRGRGQVYPTGEKSNINSFGAVQAGQISEITTSEKGESNITIINSDGVKTSQIIPAGLTLTVKQGDSVKVDQSLNIDPNVGGFGQEETEIVLQNPLRIIGYLGFCFCVLLTQVLLIIKKKQFEKVQAAELNF.

  • Molecular Weight Approximately 36 kDa (estimated).

  • Purity >90% by SDS-PAGE.

  • Tag Information The tag type is determined during the production process.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
31-314
Protein Length
full length protein
Species
Odontella sinensis (Marine centric diatom) (Biddulphia sinensis)
Target Names
petA
Target Protein Sequence
YPVFAQQGYSNPRAANGKLACANCHLNQKAIEIEAPQAVLPNSVFEVTVKVPYDTTRQQV GANGKKADLNVGGIVILPKGFKLAAKNQIPAEVKAKNKGVFISPYSTEFDNILIVGPIAG KTHQELIFPVVSPDPEKDSDVKYLTYPLYAGGNRGRGQVYPTGEKSNINSFGAVQAGQIS EITTSEKGESNITIINSDGVKTSQIIPAGLTLTVKQGDSVKVDQSLNIDPNVGGFGQEET EIVLQNPLRIIGYLGFCFCVLLTQVLLIIKKKQFEKVQAAELNF
Uniprot No.

Target Background

Function
Recombinant Odontella sinensis Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex facilitates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Odontella sinensis Apocytochrome f and what is its role in photosynthesis?

Odontella sinensis Apocytochrome f is a protein encoded by the petA gene in the marine centric diatom Odontella sinensis (also known as Biddulphia sinensis). The mature protein functions as a crucial component of the cytochrome b6/f complex in the thylakoid membrane of chloroplasts, serving as an electron carrier in the photosynthetic electron transport chain.

Apocytochrome f contains characteristic structural features including:

  • A heme binding domain with the conserved motif YX(19)CANCH

  • Acidic domains that facilitate interaction with plastocyanin

  • A C-terminal membrane anchor necessary for functional assembly

In the photosynthetic process, cytochrome f accepts electrons from cytochrome b6 and transfers them to plastocyanin, which subsequently delivers electrons to photosystem I. This electron transfer is coupled to proton translocation across the thylakoid membrane, contributing to the establishment of a proton gradient used for ATP synthesis .

How does the structure of petA gene in Odontella sinensis compare with other photosynthetic organisms?

The petA gene in Odontella sinensis exhibits several distinctive characteristics compared to its counterparts in other photosynthetic organisms:

OrganismGene LocationNotable FeaturesSize (amino acids)
Odontella sinensisChloroplastStandard f-type cytochrome structure~300
Euglena gracilisNuclearUnique 62-residue insertion; tripartite chloroplast transit peptide347 (mature protein)
Chlamydomonas reinhardtiiChloroplastSimilar to other algal cytochromes f~290
Higher plants (e.g., Brassica)ChloroplastHighly conserved structure~285

While the petA gene traditionally resides in the chloroplast genome in most photosynthetic organisms, the migration of this gene to the nucleus has been documented in Euglena gracilis. This nuclear-encoded petA contains regions that encode a large tripartite chloroplast transit peptide (CTP), which enables the import of apocytochrome f through the three-membrane envelope of chloroplasts .

The coding sequence of petA is highly conserved across diverse photosynthetic organisms, with identity levels of 52% or higher between distantly related species. This conservation highlights the critical role of cytochrome f in photosynthetic electron transport .

What are the optimal methods for extracting and purifying native Apocytochrome f from Odontella sinensis?

Extracting and purifying native Apocytochrome f from Odontella sinensis requires specialized techniques to preserve structural integrity and functional activity:

Chloroplast Isolation Protocol:

  • Harvest cells from early-stationary phase cultures (5-7 × 10^6 cells/ml) for optimal organelle separation .

  • Use French Press cell disruption at a controlled pressure (90 MPa) to preserve organelle integrity .

  • Separate intact chloroplasts using density gradient centrifugation.

  • Verify chloroplast purity through fluorescence microscopy or spectroscopic analysis.

Protein Purification Steps:

  • Solubilize thylakoid membranes using mild detergents (e.g., n-dodecyl β-D-maltoside).

  • Employ ion exchange chromatography followed by size exclusion chromatography.

  • Verify protein identity through immunochemical methods, heme-specific staining, and Edman degradation .

  • Confirm purity using SDS-PAGE and spectroscopic analysis of the heme group.

This methodology offers advantages over traditional cesium chloride gradient approaches, which are labor-intensive and require large amounts of starting material. The described approach yields physiologically intact chloroplasts suitable for subsequent protein isolation .

What are the optimal storage conditions for recombinant Apocytochrome f proteins?

Based on manufacturer recommendations and research protocols, the following storage conditions maximize stability and activity of recombinant Apocytochrome f:

Short-term Storage (up to 1 week):

  • Store working aliquots at 4°C to maintain accessibility while preserving activity .

Medium-term Storage (weeks to months):

  • Store at -20°C in a buffer containing 50% glycerol to prevent freezing damage .

  • Use Tris-based buffer systems optimized for the specific protein.

Long-term Storage (months to years):

  • Store at -80°C in small aliquots to minimize freeze-thaw cycles .

  • Include reducing agents (e.g., DTT or β-mercaptoethanol) at low concentrations to prevent oxidation of critical cysteine residues.

Critical Considerations:

  • Repeated freezing and thawing significantly reduces protein activity and should be strictly avoided .

  • Protect from light during storage to prevent photodynamic damage to the heme group.

  • Consider lyophilization for very long-term storage with appropriate cryoprotectants.

How does the evolutionary history of the petA gene in diatoms like Odontella sinensis inform our understanding of chloroplast genome evolution?

The petA gene in diatoms provides a fascinating window into chloroplast genome evolution, particularly regarding endosymbiotic gene transfer events:

Chloroplast Genome Architecture:
The chloroplast genome of Odontella sinensis was among the first stramenopile chloroplast genomes to be sequenced, revealing important insights about gene organization. Unlike higher plants, stramenopile chloroplast genomes often show limited synteny with other algal chloroplast genomes . This suggests significant genomic rearrangements during evolution.

Gene Migration Patterns:
While the petA gene remains chloroplast-encoded in Odontella sinensis, studies of Euglena gracilis demonstrate migration of this gene to the nucleus . This differential pattern informs our understanding of the timing and selective pressures driving endosymbiotic gene transfer.

Methodological Approaches:
Research on chloroplast genome evolution has been revolutionized by fosmid cloning techniques that eliminate the need for chloroplast isolation and DNA purification . This approach allows efficient comparative genomics of chloroplast genes, including petA, across diverse photosynthetic lineages.

Understanding these evolutionary patterns helps researchers interpret structural and functional variations in Apocytochrome f across species and informs experimental design when working with recombinant proteins.

What techniques are most effective for characterizing the structure-function relationship of specific domains in Odontella sinensis Apocytochrome f?

Elucidating structure-function relationships in Apocytochrome f requires integration of multiple experimental approaches:

Site-Directed Mutagenesis Strategy:

  • Identify conserved residues through sequence alignment of Apocytochrome f from multiple species.

  • Design mutations targeting:

    • The heme binding domain (YX(19)CANCH)

    • Acidic domains involved in plastocyanin interaction

    • The membrane anchor domain necessary for assembly

Functional Characterization Methods:

  • Electron Transport Assays: Measure electron transfer rates using artificial electron donors/acceptors and spectroscopic techniques.

  • Interaction Studies: Examine binding with physiological partners using:

    • Surface plasmon resonance (SPR)

    • Isothermal titration calorimetry (ITC)

    • Co-immunoprecipitation assays

Structural Analysis Approaches:

  • X-ray Crystallography: Determine high-resolution structures of wild-type and mutant proteins.

  • NMR Spectroscopy: Analyze dynamic properties and conformational changes during electron transfer.

  • Hydrogen-Deuterium Exchange Mass Spectrometry: Map interaction surfaces and conformational dynamics.

Protein Modeling Considerations:
Molecular modeling of Odontella sinensis cytochrome f can be based on crystal structures from other organisms like Chlamydomonas reinhardtii, allowing prediction of how unique structural features might influence function .

These complementary approaches provide comprehensive insights into how specific domains contribute to the electron transfer function and assembly of the cytochrome b6/f complex.

What are the challenges and solutions in expressing recombinant Odontella sinensis Apocytochrome f in heterologous systems?

Heterologous expression of Odontella sinensis Apocytochrome f presents several significant challenges due to its complex structure and cofactor requirements:

Key Challenges:

  • Heme Incorporation:

    • Cytochrome f requires proper insertion of a c-type heme cofactor

    • Solution: Co-express heme lyase or utilize specialized E. coli strains (e.g., Origami) that facilitate disulfide bond formation and heme attachment

  • Membrane Targeting:

    • The C-terminal hydrophobic domain must properly insert into membranes

    • Solution: Use specialized vectors containing N-terminal secretion signals or C-terminal fusion tags that facilitate membrane insertion

  • Codon Usage Bias:

    • Diatom genes exhibit distinct codon usage patterns compared to common expression hosts

    • Solution: Optimize codons for the expression host or use specialized strains enriched with rare tRNAs

  • Post-Translational Processing:

    • Native processing may involve specific proteases or folding chaperones

    • Solution: Co-express relevant chaperones or conduct expression in eukaryotic systems with appropriate processing machinery

Expression System Comparison:

Expression SystemAdvantagesDisadvantagesYield
E. coliCost-effective, fast growth, well-established protocolsLimited post-translational modifications, improper foldingModerate
Yeast (S. cerevisiae)Eukaryotic processing, scalableComplex media requirements, lower yieldsLow-Moderate
Insect cellsBetter post-translational processingExpensive, technically demandingModerate-High
Diatom-based systemsNative processing environmentComplex cultivation, limited genetic toolsLow

Verification Methods:
Successful expression should be verified through multiple approaches, including:

  • SDS-PAGE with heme staining

  • Western blotting with antibodies specific to Apocytochrome f

  • Absorbance spectroscopy to confirm proper heme incorporation

  • Functional assays to verify electron transfer capability

These strategies can help overcome the challenges inherent in producing functional recombinant Apocytochrome f from Odontella sinensis.

How can researchers differentiate between functional and non-functional recombinant Apocytochrome f in experimental settings?

Differentiating functional from non-functional recombinant Apocytochrome f requires multiple analytical approaches that assess both structural integrity and electron transfer capability:

Spectroscopic Characterization:

  • UV-Visible Spectroscopy: Functional cytochrome f exhibits characteristic absorption peaks at approximately 420 nm (Soret band) and 520-550 nm (α/β bands). These spectra change distinctly upon reduction/oxidation, providing a simple test for electron transfer capability.

  • Circular Dichroism (CD): Properly folded protein shows characteristic secondary structure signatures that can be compared to native protein.

  • Resonance Raman Spectroscopy: Provides detailed information about the heme environment and coordination state.

Functional Assays:

  • Electron Transfer Kinetics: Measure the rate of electron transfer from reduced cytochrome f to plastocyanin using stopped-flow spectroscopy.

  • Reconstitution Experiments: Incorporate the recombinant protein into liposomes or isolated thylakoid membranes depleted of endogenous cytochrome f, then measure restoration of electron transport.

  • Complementation Studies: Test the ability of the recombinant protein to restore function in mutant strains deficient in cytochrome f.

Structural Analysis:

  • Limited Proteolysis: Properly folded proteins typically show distinct proteolytic patterns compared to misfolded variants.

  • Thermal Stability Assays: Differential scanning calorimetry or fluorescence-based thermal shift assays can assess structural integrity.

  • Size Exclusion Chromatography: Evaluates oligomeric state and proper folding.

Activity Ratios:
Calculate the ratio of spectroscopic activity to protein concentration to determine specific activity, which should be comparable to native protein.

These methods collectively provide a comprehensive assessment of whether a recombinant Apocytochrome f preparation contains functionally active protein suitable for downstream applications.

What methodologies are recommended for studying the interaction between Apocytochrome f and other components of the photosynthetic electron transport chain?

Investigating the interactions between Apocytochrome f and other photosynthetic electron transport components requires specialized methodologies:

Protein-Protein Interaction Analysis:

  • Surface Plasmon Resonance (SPR): Quantify binding kinetics (kon/koff) and affinities (KD) between cytochrome f and its interaction partners, particularly plastocyanin. Immobilize one protein on a sensor chip and measure binding in real-time.

  • Isothermal Titration Calorimetry (ITC): Determine thermodynamic parameters (ΔH, ΔS, ΔG) of binding interactions.

  • Förster Resonance Energy Transfer (FRET): Label cytochrome f and potential interaction partners with appropriate fluorophore pairs to detect proximity in vitro or in vivo.

Electron Transfer Measurements:

  • Fast Kinetic Spectroscopy: Use laser flash photolysis or stopped-flow spectroscopy to measure electron transfer rates between cytochrome f and plastocyanin or cytochrome b6.

  • Electrochemical Approaches: Protein film voltammetry can determine redox potentials and electron transfer rates.

  • EPR Spectroscopy: Characterize paramagnetic species formed during electron transfer.

Structural Biology Approaches:

  • Cross-linking Coupled with Mass Spectrometry: Identify interaction interfaces between cytochrome f and other components.

  • Cryo-Electron Microscopy: Visualize the entire cytochrome b6/f complex with interaction partners.

  • X-ray Crystallography: Solve structures of co-crystallized protein complexes.

In vivo Analysis:

  • Split Fluorescent Protein Complementation: Assess protein interactions in intact cells.

  • Mutational Analysis: Create targeted mutations in predicted interaction domains and assess functional consequences.

These methodological approaches provide complementary insights into how Apocytochrome f interacts with other components of the photosynthetic machinery, advancing our understanding of electron transport mechanisms in photosynthetic organisms.

How does the degradation and turnover of Apocytochrome f occur in chloroplasts, and what experimental approaches can be used to study these processes?

The degradation and turnover of Apocytochrome f involve sophisticated proteolytic systems within the chloroplast that regulate protein homeostasis. Understanding these processes is crucial for interpreting experimental results involving recombinant proteins:

Proteolytic Systems Involved:

  • Clp Protease Complex: Evidence suggests that the Clp protease plays a central role in the degradation of cytochrome b6/f complex components, including Apocytochrome f . In Chlamydomonas, mutations affecting ClpP expression have been shown to impact the degradation of cytochrome f.

  • FtsH Proteases: Membrane-bound metalloproteases likely involved in quality control of thylakoid membrane proteins.

  • Deg Proteases: Serine proteases activated under stress conditions that may contribute to cytochrome f turnover.

Half-life and Regulatory Factors:
The stability of Apocytochrome f is influenced by:

  • Assembly status within the cytochrome b6/f complex

  • Light conditions and redox state

  • Translation of other complex components (particularly PetB and PetD)

Experimental Approaches:

  • Pulse-Chase Analysis:

    • Label proteins with radioactive amino acids (e.g., 35S-Met)

    • Track degradation over time through immunoprecipitation and autoradiography

    • Quantify half-life under different experimental conditions

  • Inhibitor Studies:

    • Apply specific protease inhibitors to identify enzymes involved

    • Measure accumulation of cytochrome f under different inhibitor treatments

  • Genetic Approaches:

    • Use mutants defective in specific proteases (e.g., clpP-AUU mutants)

    • Analyze cytochrome f stability in these backgrounds

    • Employ inducible RNAi systems to deplete specific proteases

  • Fluorescent Protein Fusions:

    • Create fusions with photoconvertible fluorescent proteins

    • Track degradation kinetics in vivo using confocal microscopy

  • Mass Spectrometry Approaches:

    • Identify degradation intermediates

    • Map protease cleavage sites

    • Quantify protein abundance using SILAC or TMT labeling

Understanding these degradation mechanisms is essential for experiments involving recombinant Apocytochrome f, as they affect protein stability and turnover rates in experimental systems.

What are the implications of petA gene migration from chloroplast to nucleus in some species, and how can researchers study this phenomenon?

The migration of the petA gene from the chloroplast to the nuclear genome, as observed in Euglena gracilis but not in Odontella sinensis, represents a fascinating example of endosymbiotic gene transfer with significant implications for protein function and cellular evolution:

Evolutionary Implications:

  • Genome Reduction: The transfer of chloroplast genes to the nucleus is part of the ongoing reduction of the organellar genome during endosymbiotic evolution.

  • Control Shift: Gene transfer places expression under nuclear control, allowing integration with cellular regulatory networks.

  • Selective Pressures: The retention of petA in the chloroplast genome of most photosynthetic organisms (including Odontella sinensis) suggests potential barriers to transfer or selective advantages of chloroplast localization.

Functional Consequences:

  • Protein Targeting: Nuclear-encoded petA acquires sequences encoding chloroplast transit peptides (CTPs) for proper targeting. In Euglena gracilis, this involves a large tripartite CTP necessary for traversing the three-membrane chloroplast envelope .

  • Codon Usage: Nuclear-encoded petA exhibits nuclear codon bias, distinct from chloroplast genes . This change in codon optimization may affect translation efficiency.

  • Processing Complexity: Additional processing steps are required, including cytosolic translation, chloroplast import, and transit peptide cleavage.

Research Methodologies:

MethodApplicationKey Insights
Southern & Northern HybridizationGene localization & expressionDetermine genomic location (nuclear vs. chloroplast) and transcript size
Codon Usage AnalysisEvolutionary signaturesDistinguish nuclear from chloroplast gene origin based on codon preferences
Transit Peptide AnalysisProtein targeting mechanismsIdentify specialized targeting sequences (e.g., bipartite or tripartite CTPs)
Pulse-chase ExperimentsProtein import kineticsTrack precursor processing and chloroplast localization
Phylogenetic AnalysisEvolutionary historyDetermine timing and frequency of independent gene transfer events

Experimental Approaches:

  • Construct chimeric genes with transit peptides from nuclear-encoded petA fused to reporter proteins

  • Compare expression levels, stability, and functional integration of chloroplast vs. nuclear-encoded petA

  • Assess the impact of codon optimization on translation efficiency and protein accumulation

Understanding this phenomenon provides important insights into the evolution of photosynthetic organisms and the mechanisms of protein targeting to chloroplasts.

How can researchers effectively use recombinant Odontella sinensis Apocytochrome f in structural biology and protein-protein interaction studies?

Recombinant Odontella sinensis Apocytochrome f serves as a valuable tool for structural biology and protein-protein interaction studies, offering insights into photosynthetic electron transport mechanisms:

Sample Preparation Strategies:

  • Optimization for Structural Studies:

    • Express protein with removable affinity tags (His6, GST) for purification

    • Use buffer screening to identify conditions that enhance stability and homogeneity

    • Remove flexible regions (e.g., membrane anchor) to improve crystallization propensity

    • Implement on-column heme reconstitution during purification to ensure proper cofactor incorporation

  • Protein Stabilization Approaches:

    • Introduce disulfide bonds through rational design to enhance stability

    • Use nanobodies or single-chain antibodies as crystallization chaperones

    • Employ deuteration for improved NMR studies

    • Consider lipid nanodisc incorporation for membrane domain studies

Methodological Approaches:

  • X-ray Crystallography:

    • Use sparse matrix screening to identify initial crystallization conditions

    • Optimize diffraction quality through additive screening and seeding techniques

    • Consider crystallization with binding partners to capture interaction interfaces

    • Resolution enhancement through post-crystallization treatments (dehydration, annealing)

  • Cryo-Electron Microscopy:

    • Study the entire cytochrome b6/f complex with Apocytochrome f in its native context

    • Use Volta phase plates for enhanced contrast of smaller complexes

    • Employ GraFix method to stabilize transient complexes prior to grid preparation

  • NMR Spectroscopy:

    • Focus on specific domains or interactions using selectively labeled proteins

    • Apply transferred NOE experiments to study transient interactions

    • Implement paramagnetic relaxation enhancement to map interaction surfaces

  • Interaction Analysis:

    • Microscale thermophoresis for quantitative binding studies

    • Hydrogen-deuterium exchange mass spectrometry to map binding interfaces

    • Bio-layer interferometry for real-time interaction kinetics

Data Integration: Combine multiple structural and biophysical techniques to develop comprehensive models of Apocytochrome f function, particularly focusing on how its unique features in Odontella sinensis might influence electron transfer properties and complex assembly.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.