Recombinant Odontella sinensis ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes, and we will strive to fulfill your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipment is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-242
Protein Length
full length protein
Species
Odontella sinensis (Marine centric diatom) (Biddulphia sinensis)
Target Names
atpI
Target Protein Sequence
MYPDNFYSSTFTLLAEAEVGKHFYWDIAGFLVHGQVLVVVWFVLALLLLFAVLGTRDIDR IPNSWQNFAESAVDFVTDIARDQLGESFYREWVPFIGTLFLFIFGCNWAGAIIPWKLIEL PEGELAAPTNDINTTVALALLTSLAYFYAGLSKKGFGYFKRYIQPIPLLLPINILEDFTK PLSLSFRLFGNVLADELTITVLTSLVPLVIPLPIMALGIFAGSVQALIFSTLAAAYIAEA LE
Uniprot No.

Target Background

Function
As a key component of the proton channel, ATP synthase subunit a plays a direct role in the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Odontella sinensis ATP synthase subunit a (atpI) and what is its role in cellular function?

Odontella sinensis ATP synthase subunit a, also known as atpI, functions as a critical component of the chloroplastic ATP synthase complex in this marine centric diatom. The atpI gene encodes subunit IV of the ATP synthase, which forms part of the membrane-bound F0 sector of the enzyme complex . This subunit plays an essential role in proton translocation across the thylakoid membrane, a process that is mechanically coupled to ATP synthesis. The full-length protein consists of 242 amino acids and contains transmembrane domains characteristic of its role in the membrane-embedded portion of ATP synthase . The atpI subunit contributes to maintaining the proton gradient that drives the rotation of the c-subunit ring, ultimately powering the catalytic synthesis of ATP in the F1 region of the complex .

How does the chloroplast genome organization in Odontella sinensis differ from other photosynthetic organisms?

The chloroplast genome organization in Odontella sinensis exhibits remarkable evolutionary differences compared to land plants and other photosynthetic organisms. In Odontella sinensis, six closely linked reading frames have been identified in the large single copy region of the chloroplast genome, including atpI, atpH, atpG, atpF, atpD, and atpA, which code for subunits IV, III, II, I, delta, and alpha, respectively .

What distinguishes Odontella sinensis from chlorophyll a + b plants is that genes like atpG and atpD are present in the chloroplast gene cluster, whereas they are nucleus-encoded in land plants . Interestingly, the mapping positions of these genes in Odontella sinensis are similar to those found in cyanobacteria, suggesting a distinct evolutionary trajectory for chlorophyll a + c-containing chromophytic plastids . Additionally, in Odontella sinensis, the genes atpD and atpF overlap by four base-pairs, a characteristic shared with certain photosynthetic and heterotrophic eubacteria .

What are the recommended methods for handling recombinant Odontella sinensis atpI protein in laboratory settings?

When working with recombinant Odontella sinensis ATP synthase subunit a (atpI) protein in laboratory settings, researchers should implement the following methodological approaches:

Reconstitution Protocol:

  • Briefly centrifuge the vial containing lyophilized protein before opening to ensure all material settles at the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (recommended standard is 50%) for long-term storage

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles

Storage Conditions:

  • Store lyophilized powder at -20°C/-80°C upon receipt

  • Store working aliquots at 4°C for up to one week

  • For long-term storage of reconstituted protein, maintain at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles as this can compromise protein integrity

Buffer Considerations:

  • The protein is typically provided in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

  • This buffer composition helps maintain protein stability during storage

What expression systems are most effective for producing recombinant membrane proteins like Odontella sinensis atpI?

Based on available research data, Escherichia coli represents the most widely used and effective expression system for producing recombinant membrane proteins like Odontella sinensis atpI. The recombinant His-tagged atpI protein is successfully expressed in E. coli, indicating that bacterial expression systems can properly handle the production of this chloroplastic membrane protein .

When designing expression strategies for membrane proteins like atpI, researchers should consider:

  • Fusion Tag Selection: The addition of His-tags facilitates purification through affinity chromatography while minimizing interference with protein structure and function. For Odontella sinensis atpI, N-terminal His-tagging has been demonstrated to be effective .

  • Vector Choice: Drawing from methodologies used for similar proteins, vectors like pMAL-c2x, pET-32a(+), and pFLAG-MAC have shown utility for expressing membrane proteins from photosynthetic organisms. These vectors offer different promoters and fusion partners that can enhance solubility and expression levels .

  • Codon Optimization: Synthetic gene design with codons optimized for E. coli expression can significantly improve protein yields, as demonstrated in similar ATP synthase subunit expression systems .

  • Chaperone Co-expression: For challenging membrane proteins, co-transformation with vectors expressing chaperone proteins such as DnaK, DnaJ, and GrpE can substantially increase recombinant protein yields by assisting with proper folding .

How does the evolutionary positioning of atpI in the chloroplast genome of Odontella sinensis inform our understanding of endosymbiotic events?

The unique genomic arrangement of ATP synthase genes in Odontella sinensis provides critical insights into endosymbiotic events and the evolution of diatom chloroplasts. The presence of atpG and atpD genes in the chloroplast genome of Odontella sinensis, rather than in the nuclear genome as observed in chlorophyll a + b plants, suggests a distinct evolutionary trajectory for diatom plastids .

This genomic organization more closely resembles that of cyanobacteria, which aligns with the endosymbiotic theory but indicates that gene transfer to the nucleus occurred differently in the lineage leading to diatoms compared to green plants . The four base-pair overlap between atpD and atpF genes in Odontella sinensis further mimics arrangements seen in certain photosynthetic and heterotrophic eubacteria, providing additional evidence for the conservation of ancient gene organizations .

Furthermore, upstream from the atpA gene cluster in Odontella sinensis, researchers identified an open reading frame coding for 251 amino acid residues that shows sequence similarity to ATP-binding subunits of periplasmic prokaryotic and eukaryotic transport systems. Notably, this reading frame is absent in land plant chloroplast genomes analyzed to date . This difference highlights the complex evolutionary history of chromophytic plastids and suggests distinct selective pressures acting on diatom energy metabolism pathways compared to those in land plants.

What methodologies can researchers employ to investigate the functional properties of recombinant Odontella sinensis atpI?

To investigate the functional properties of recombinant Odontella sinensis atpI, researchers can employ several sophisticated methodologies:

1. Reconstitution into Liposomes:

  • Incorporate purified recombinant atpI into artificial lipid bilayers

  • Measure proton translocation using pH-sensitive fluorescent dyes

  • Assess functionality by coupling with other ATP synthase subunits in proteoliposome systems

2. Structural Analysis:

  • Circular dichroism (CD) spectroscopy to confirm the alpha-helical secondary structure, which is characteristic of functional ATP synthase subunits

  • Cryo-electron microscopy to visualize the integration of atpI within reconstituted complexes

  • NMR spectroscopy for detailed structural analysis of membrane-protein interactions

3. Mutational Analysis:

  • Site-directed mutagenesis of key residues predicted to be involved in proton translocation

  • Functional assays comparing wild-type and mutant proteins to identify critical amino acids

  • Assessment of assembly competence through co-expression with other ATP synthase subunits

4. Electrophysiological Studies:

  • Patch-clamp analysis of membranes containing reconstituted atpI to measure ion conductance

  • Correlation with native Odontella sinensis electrophysiological properties, particularly considering that this organism exhibits fast Na+/Ca2+-based action potentials

5. In silico Modeling:

  • Molecular dynamics simulations to predict proton pathways through the protein

  • Comparative modeling with known structures from other organisms to identify conserved functional domains

How does the c-ring stoichiometry in diatom ATP synthases compare to other organisms, and what are the implications for bioenergetics?

The c-ring stoichiometry in ATP synthases varies significantly among different organisms, with profound implications for bioenergetic efficiency. While the specific c-ring stoichiometry for Odontella sinensis has not been definitively determined, research on other organisms provides a framework for understanding potential variations and their functional significance.

The number of c-subunits per ring (n) has been documented to range from c10 to c15 among various organisms, as shown in the following comparative table:

Organismc-ring StoichiometryCoupling Ratio (H+:ATP)
Yeast (S. cerevisiae)c103.3
Mammalian (Bos taurus)c82.7
Cyanobacteria (I. tartaricus)c113.7
Spinach chloroplastc144.7
Spirulina platensisc155.0

Note: Data compiled from research on ATP synthase c-ring stoichiometry

This variation in c-ring stoichiometry directly affects the bioenergetic coupling ratio (protons translocated:ATP molecules synthesized), which ranges from 3.3 to 5.0 among these organisms . The coupling ratio is determined by the equation:

H+/ATP = c/3

Where c is the number of c-subunits and 3 represents the constant number of ATP molecules generated per complete rotation of the c-ring .

For diatoms like Odontella sinensis, determining this stoichiometry would provide crucial insights into their energetic efficiency. A higher c-ring stoichiometry would indicate a greater number of protons required per ATP synthesized, potentially reflecting adaptation to environments with abundant light energy but where ATP synthesis needs to be carefully regulated. Conversely, a lower c-ring stoichiometry would suggest optimization for ATP production efficiency when energy input is limited.

The unique evolutionary position of diatoms, with their distinct chloroplast genome organization, raises intriguing questions about whether their c-ring stoichiometry might represent an intermediate evolutionary state or a specialized adaptation to marine environments.

What relationship exists between the electrophysiological properties of Odontella sinensis and its ATP synthase function?

Odontella sinensis exhibits distinctive electrophysiological properties that are intricately connected to its energy metabolism and ATP synthase function. Unlike some other diatoms, Odontella sinensis displays fast Na+/Ca2+-based action potentials, a characteristic that may be related to its unique ion channel composition .

Research has identified that Odontella sinensis possesses both voltage-gated calcium channels (Cav) and eukaryotic cation channels (EukCatAs) . This dual channel system distinguishes it from some other diatoms, such as the pennate Phaeodactylum tricornutum, which lacks Cav channels entirely . This difference in calcium channel composition may influence membrane polarization dynamics, potentially affecting the electrochemical gradient that drives ATP synthase activity.

The relationship between these electrophysiological properties and ATP synthase function likely involves:

  • Gradient Maintenance: The action potentials may contribute to maintaining optimal ion gradients across membranes, indirectly supporting the proton motive force required for ATP synthesis.

  • Signaling Integration: Calcium signaling, facilitated by the channels identified in Odontella sinensis, may coordinate photosynthetic activity with ATP production based on environmental conditions.

  • Adaptive Response: The presence of multiple calcium channel types might allow for more sophisticated regulation of energy metabolism in response to changing marine conditions.

Further investigation is needed to fully characterize how these electrophysiological properties specifically interact with ATP synthase function in Odontella sinensis, particularly regarding whether the unique gene arrangements in the chloroplast genome (including atpI) contribute to specialized regulatory mechanisms for ion homeostasis and energy coupling.

What approaches can be used to investigate the assembly and interactions of atpI with other ATP synthase subunits?

To investigate the assembly and interactions of atpI with other ATP synthase subunits in Odontella sinensis, researchers can employ several sophisticated methodological approaches:

1. Co-immunoprecipitation (Co-IP) and Pull-down Assays:

  • Utilize the His-tagged recombinant atpI protein for pull-down experiments to identify interacting partners

  • Perform reciprocal Co-IP with antibodies against other ATP synthase subunits to confirm specific interactions

  • Analyze resulting protein complexes using mass spectrometry to identify the complete interaction network

2. Crosslinking Mass Spectrometry:

  • Apply chemical crosslinkers to stabilize transient protein-protein interactions

  • Digest crosslinked complexes and analyze by mass spectrometry

  • Map the interaction interfaces between atpI and other subunits at the amino acid level

3. Förster Resonance Energy Transfer (FRET):

  • Generate fluorescently labeled atpI and potential interacting partners

  • Measure energy transfer between fluorophores as an indicator of protein proximity

  • Use this approach to visualize interactions in reconstituted membrane systems

4. Blue Native PAGE and Complex Analysis:

  • Analyze intact ATP synthase complexes using mild detergent extraction and blue native gel electrophoresis

  • Compare complexes formed with wild-type versus mutant atpI to identify assembly defects

  • Combine with second-dimension SDS-PAGE to identify subunit composition

5. Cryo-Electron Microscopy:

  • Visualize the entire ATP synthase complex at near-atomic resolution

  • Map the position of atpI within the membrane domain

  • Identify structural changes in complexes with modified atpI variants

6. Reconstitution Studies:

  • Systematically reconstitute the ATP synthase complex using purified subunits including recombinant atpI

  • Assess functionality of reconstituted complexes through ATP synthesis assays

  • Determine minimum subunit requirements for proper assembly and function

These methodologies, particularly when used in combination, can provide comprehensive insights into how atpI interacts with other ATP synthase subunits and contributes to the assembly and function of the complete enzyme complex in Odontella sinensis.

How do the structural and functional properties of atpI differ between diatoms and other photosynthetic organisms?

The structural and functional properties of ATP synthase subunit a (atpI) in diatoms like Odontella sinensis show distinctive characteristics when compared to other photosynthetic organisms, reflecting their unique evolutionary history and adaptation to marine environments.

At the genomic level, the most striking difference is the location of ATP synthase genes. In Odontella sinensis, the atpI gene is part of a gene cluster in the chloroplast genome along with atpH, atpG, atpF, atpD, and atpA . This arrangement differs from that in land plants, where some of these genes (particularly atpG and atpD) have been transferred to the nuclear genome during evolution . The gene arrangement in Odontella sinensis more closely resembles that of cyanobacteria, suggesting a distinct evolutionary pathway for diatom chloroplasts .

The atpI protein in Odontella sinensis consists of 242 amino acids, forming a transmembrane protein with several predicted membrane-spanning domains . While the core function of proton translocation is conserved across species, sequence analysis reveals adaptations that may reflect the specific membrane environment and bioenergetic requirements of marine diatoms.

Functionally, the integration of atpI within the ATP synthase complex must accommodate the unique ionic characteristics of the diatom cellular environment. Odontella sinensis exhibits distinctive electrophysiological properties, including fast Na+/Ca2+-based action potentials , which may influence the operation of membrane-bound complexes like ATP synthase. This contrasts with land plants, which typically lack such rapid action potential mechanisms in their chloroplasts.

The specific adaptations in atpI structure and function likely contribute to the remarkable success of diatoms in marine ecosystems, where they account for approximately 20% of global photosynthesis despite facing different environmental challenges than terrestrial plants.

What research gaps remain in our understanding of Odontella sinensis ATP synthase and how might they be addressed?

Despite significant advances in our understanding of ATP synthase in various organisms, several critical research gaps remain specific to Odontella sinensis ATP synthase that warrant further investigation:

1. C-ring Stoichiometry Determination:
The exact number of c-subunits in the ATP synthase ring of Odontella sinensis remains undetermined. This information is crucial for understanding the H+/ATP coupling ratio and bioenergetic efficiency. Researchers could address this through:

  • Cryo-electron microscopy of isolated ATP synthase complexes

  • Mass determination techniques coupled with sequence analysis

  • Comparative functional studies with organisms of known stoichiometry

2. Regulatory Mechanisms:
The regulatory pathways that control ATP synthase activity in response to changing environmental conditions (light, temperature, salinity) in marine diatoms remain poorly characterized. Future research could employ:

  • Transcriptomic and proteomic profiling under various conditions

  • Analysis of post-translational modifications specific to diatom ATP synthase subunits

  • In vivo imaging techniques to monitor ATP synthase assembly and activity

3. Evolutionary Adaptation:
How the unique evolutionary history of diatom chloroplasts has shaped ATP synthase function represents a significant knowledge gap. This could be explored through:

  • Comprehensive phylogenetic analysis of ATP synthase genes across diatom species

  • Functional comparison of recombinant atpI from various diatoms

  • Ancestral sequence reconstruction and functional testing of predicted evolutionary intermediates

4. Structural-Functional Relationships:
The specific structural features of Odontella sinensis atpI that determine its function and assembly remain to be elucidated. Future research approaches might include:

  • Site-directed mutagenesis of conserved and divergent residues

  • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

  • Computational modeling of proton translocation pathways

5. Integration with Photosynthetic Machinery:
The coordination between ATP synthase activity and other components of the photosynthetic apparatus in diatoms presents an important area for investigation. Researchers could address this through:

  • Analysis of supercomplexes containing ATP synthase and other photosynthetic complexes

  • Investigation of spatial organization within the thylakoid membrane

  • Metabolic flux analysis to determine rate-limiting steps in energy conversion

Addressing these research gaps would significantly advance our understanding of bioenergetics in diatoms and potentially reveal novel adaptations that contribute to their ecological success in marine environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.