Recombinant Odontella sinensis Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Odontella sinensis (Marine centric diatom) (Biddulphia sinensis)
Target Names
petD
Target Protein Sequence
MSVIKKPDLTDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVCILGTFACCIGLAVMAPT QMGEPADPFNTPLEILPEWYFFPTFNLLRVLPNKLLGVLAMARVPAGLITVPFIENVNKF QNPFRRPIASLVFILGFFTAVWLGIGACLPIDKAVSLGFW
Uniprot No.

Target Background

Function

Function: A component of the cytochrome b6-f complex, mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of cytochrome b6-f complex subunit 4 (petD) in photosynthesis?

Cytochrome b6-f complex subunit 4 (petD) plays a critical role in the electron transport chain within the thylakoid membranes of chloroplasts. It facilitates the transfer of electrons between photosystem II (PSII) and photosystem I (PSI), contributing to the generation of a proton gradient across the thylakoid membrane. This proton gradient drives ATP synthesis through ATP synthase, which is essential for energy production during photosynthesis . The petD subunit specifically interacts with other components of the cytochrome b6-f complex to ensure proper assembly and functionality. Its structural integrity is crucial for maintaining efficient electron flow and preventing energy dissipation .

Experimental approaches to study petD function often involve mutagenesis or recombinant protein expression systems. For example, site-directed mutagenesis can be used to identify amino acid residues critical for electron transfer or protein-protein interactions within the complex . Additionally, biochemical assays measuring electron transport rates or proton gradient formation can elucidate the functional consequences of petD modifications.

How does recombinant expression of petD in Odontella sinensis differ from its native expression in other species?

Recombinant expression systems allow researchers to produce petD in controlled environments, often using heterologous hosts such as Escherichia coli or yeast. In Odontella sinensis, petD expression is influenced by unique regulatory elements associated with its plastid genome, which has undergone evolutionary adaptations due to tertiary endosymbiosis . These adaptations may include codon usage bias, promoter sequences, and post-transcriptional modifications specific to diatoms.

To compare recombinant and native expression, researchers can analyze transcriptional and translational efficiency using quantitative PCR and proteomics approaches. Furthermore, structural studies employing X-ray crystallography or cryo-electron microscopy can reveal differences in protein folding or complex assembly between recombinant and native systems . These studies provide insights into how evolutionary pressures shape protein function and stability.

What experimental techniques are used to study the structure-function relationship of petD?

Understanding the structure-function relationship of petD requires an integrative approach combining molecular biology, biochemistry, and structural biology techniques. Key methods include:

  • Site-directed mutagenesis: This technique allows researchers to alter specific amino acid residues within petD to assess their impact on electron transfer or complex stability .

  • Protein purification: Recombinant petD can be expressed in a heterologous system, purified using affinity chromatography, and analyzed for its biochemical properties.

  • Cryo-electron microscopy (cryo-EM): Cryo-EM provides high-resolution images of the cytochrome b6-f complex, enabling visualization of petD's spatial arrangement within the complex .

  • Spectroscopic methods: Techniques such as electron paramagnetic resonance (EPR) or UV-visible spectroscopy can be used to study electron transfer dynamics mediated by petD.

Combining these techniques allows researchers to correlate structural features with functional outcomes, advancing our understanding of photosynthetic electron transport mechanisms.

How does tertiary endosymbiosis influence the evolution of plastid genes like petD in diatoms?

Tertiary endosymbiosis has profoundly impacted the evolution of plastid genes in diatoms such as Odontella sinensis. This process involves the acquisition of plastids from a eukaryotic algal endosymbiont rather than directly from cyanobacteria. As a result, plastid genomes exhibit unique features such as reduced gene content, altered gene organization, and novel regulatory mechanisms .

Comparative genomic studies have shown that tertiary endosymbiosis leads to accelerated nucleotide substitution rates in plastid genes like petD . These changes may reflect adaptations to new cellular environments or selective pressures associated with diatom-specific ecological niches. Phylogenetic analyses using concatenated plastid gene sequences can help trace the evolutionary history of petD and its homologs across different algal lineages.

To study these evolutionary effects experimentally, researchers often use transcriptomics or proteomics approaches to compare gene expression profiles under varying environmental conditions. Additionally, molecular phylogenetics tools such as Bayesian inference or maximum likelihood methods are employed to reconstruct evolutionary relationships among plastid genes .

How can researchers address contradictions in nucleotide substitution rate data for plastid genes like petD?

Contradictions in nucleotide substitution rate data often arise due to methodological differences or biological factors influencing gene evolution. For example, studies may report varying substitution rates depending on whether they analyze coding versus non-coding regions or use different models of molecular evolution .

To resolve these contradictions, researchers should:

  • Ensure consistent data collection methods across studies, including standardized sequencing protocols and alignment algorithms.

  • Use robust statistical models that account for lineage-specific effects and codon usage bias.

  • Perform cross-validation analyses using independent datasets or alternative phylogenetic methods.

Experimental validation can also help clarify ambiguous results. For instance, measuring functional consequences of nucleotide substitutions through biochemical assays or mutagenesis experiments can provide direct evidence for adaptive changes in petD.

What are the challenges associated with studying PSI-deficient mutants lacking functional petD?

PSI-deficient mutants lacking functional petD present several challenges due to their impaired photosynthetic capacity and altered cellular metabolism . These mutants often exhibit increased turnover rates for other PSI subunits, complicating efforts to isolate specific effects attributable to petD deficiency.

To overcome these challenges, researchers can use conditional expression systems that allow controlled silencing or activation of petD under specific conditions. Additionally, advanced imaging techniques such as fluorescence microscopy can be employed to monitor changes in chloroplast structure or function in real-time.

Biochemical assays measuring PSI activity or electron transport rates provide quantitative data on mutant phenotypes. Combining these approaches with transcriptomic analyses enables comprehensive characterization of cellular responses to petD deficiency.

How do codon usage patterns affect recombinant expression of petD?

Codon usage patterns significantly influence recombinant expression efficiency by affecting translation rates and protein folding dynamics . In diatoms like Odontella sinensis, codon usage bias reflects adaptations associated with tertiary endosymbiosis and plastid genome evolution.

To optimize recombinant expression of petD, researchers often modify codon sequences to match those preferred by the host organism's translational machinery. This process involves designing synthetic gene constructs with optimized codons while preserving functional domains critical for protein activity.

Experimental validation includes assessing protein yield and activity levels through SDS-PAGE analysis and enzymatic assays. Structural studies ensure that codon optimization does not compromise protein folding or complex assembly.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.