Recombinant Odontella sinensis Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for prioritized development.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Odontella sinensis (Marine centric diatom) (Biddulphia sinensis)
Target Names
petB
Target Protein Sequence
MGKVYDWFEERLEIQAIADDISSKYVPPHVNIFYCFGGIVFTCFLVQVATGFAMTFYYRP SVVDAFASVEYIMTSVNFGWLIRSIHRWSASMMVMMMVLHVFRVYLTGGFKKPRELTWVT GVILAVVTVSFGVTGYSLPWDQVGFWACKIVTGVPAAVPVVGPPLVLVLRGGESVGQSTL TRFYSAHTFVLPLAAAVLMLTHFLMIRKQGISGPL
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Odontella sinensis Cytochrome b6 and what is its function in photosynthetic organisms?

Odontella sinensis Cytochrome b6 is a protein encoded by the petB gene in the chloroplast genome of this marine centric diatom (also known as Biddulphia sinensis). The protein is a critical component of the cytochrome b6/f complex, which plays an essential role in the electron transport chain during photosynthesis. This complex functions as an electronic connection between photosystems I and II, facilitating proton transfer across the thylakoid membrane and contributing to the generation of ATP .

The protein consists of 215 amino acids and has a well-conserved structure among photosynthetic organisms. Its primary function involves mediating electron transfer from plastoquinol to plastocyanin while simultaneously contributing to proton translocation across the thylakoid membrane. This process is fundamental to the light-dependent reactions of photosynthesis and energy production in photosynthetic organisms .

How should recombinant Odontella sinensis Cytochrome b6 be stored and handled in laboratory settings?

For optimal stability and activity of recombinant Odontella sinensis Cytochrome b6, the protein should be stored at -20°C for routine storage, and at -80°C for extended long-term storage. The protein is typically provided in a Tris-based buffer with 50% glycerol, which has been optimized specifically for this protein's stability .

When working with the protein, it's crucial to avoid repeated freeze-thaw cycles as these can significantly degrade protein quality and activity. For ongoing experiments, working aliquots can be stored at 4°C for up to one week. If reconstitution is required, the protein should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage of reconstituted protein, adding glycerol to a final concentration of 5-50% is recommended before aliquoting and storing at -20°C or -80°C .

What expression systems are commonly used for producing recombinant Odontella sinensis Cytochrome b6?

For the production of recombinant Odontella sinensis Cytochrome b6, Escherichia coli is the most commonly employed expression system. This approach is evidenced by similar proteins like the Prochlorothrix hollandica Cytochrome b6, which has been successfully expressed in E. coli with N-terminal His-tag fusion for purification purposes .

The methodology typically involves cloning the petB gene from Odontella sinensis into an appropriate expression vector containing an affinity tag (commonly His-tag) to facilitate purification. The protein is expressed in E. coli under controlled conditions, including optimal temperature, induction time, and media composition to maximize yield while ensuring proper folding. After expression, the protein is purified through affinity chromatography, typically using nickel or cobalt columns that bind the His-tag, followed by additional purification steps if necessary. The final product is often formulated in a Tris-based buffer with glycerol for stability .

E. coli is preferred due to its rapid growth, high protein yield, and established protocols for membrane protein expression, despite the challenges associated with expressing eukaryotic proteins in prokaryotic systems. For applications requiring post-translational modifications or more native-like folding, alternative expression systems like yeast or insect cells might be considered, though these are less commonly reported for this specific protein.

How is the petB gene organized in the chloroplast genome of Odontella sinensis, and how does this organization compare to other photosynthetic organisms?

The petB gene in Odontella sinensis is located in the chloroplast genome and encodes the cytochrome b6 protein, a critical component of the cytochrome b6/f complex. Comparative genomic analysis reveals interesting patterns in gene organization across different photosynthetic lineages.

In Odontella sinensis, the petB gene is part of a conserved gene cluster that includes other components of the photosynthetic apparatus. Analysis of chloroplast genome organization shows that some gene clusters are highly conserved across diverse photosynthetic organisms, while others show lineage-specific arrangements. The cytochrome b6/f complex genes, including petB, often show conservation in their relative positioning, reflecting the functional importance and evolutionary constraints on these genes .

The comparative analysis of chloroplast genomes across different photosynthetic organisms has revealed that petB is part of specific gene clusters. For instance, in some organisms, petA-petL-petG forms a conserved cluster. The table below shows the presence and organization of some genes related to photosynthetic functions across different organisms:

GeneCyanophoraGuillardiaOdontellaNephroselmisMarchantiaNicotiana
ccsA
psaC
psbA

In this table, ● indicates the gene's presence in the smallest segment delimited by rRNA operons, while ○ indicates its presence in the largest segment delimited by these operons .

What are the structural characteristics of Odontella sinensis Cytochrome b6 that contribute to its function, and how can researchers study its structure-function relationship?

The Odontella sinensis Cytochrome b6 protein possesses several key structural characteristics that are critical for its function in photosynthetic electron transport. The protein consists of four transmembrane helices that anchor it within the thylakoid membrane, with connecting loops extending into the stromal and lumenal spaces. The protein contains two b-type hemes (heme b6L and heme b6H) and one c-type heme (heme ci), which are essential for its electron transfer function .

To study the structure-function relationship of this protein, researchers can employ several methodological approaches:

  • Site-directed mutagenesis: Key residues involved in heme binding (such as histidine ligands) or those in the quinol binding pocket can be mutated to analyze their contribution to function.

  • Spectroscopic analysis: Techniques such as UV-visible absorption spectroscopy, electron paramagnetic resonance (EPR), and resonance Raman spectroscopy can be used to characterize the heme environments and redox properties.

  • Protein crystallography: Though challenging for membrane proteins, X-ray crystallography or cryo-electron microscopy could provide high-resolution structural information if the protein can be successfully crystallized or prepared for imaging.

  • Molecular dynamics simulations: Computational approaches can model the dynamics of the protein within a membrane environment and predict how structural changes might affect function.

  • Reconstitution experiments: The purified recombinant protein can be reconstituted into liposomes to study electron transfer activities under controlled conditions.

The amino acid sequence (provided in section 1.3) reveals conserved histidine residues that likely serve as heme ligands, as well as transmembrane regions rich in hydrophobic amino acids. By comparing sequences across species and correlating with functional data, researchers can identify critical residues and structural elements that are essential for the protein's role in electron transport .

What are the challenges in expressing and purifying functional recombinant Odontella sinensis Cytochrome b6, and how can these challenges be addressed?

Expressing and purifying functional recombinant Odontella sinensis Cytochrome b6 presents several significant challenges due to its nature as a membrane protein with multiple cofactors. These challenges and their potential solutions include:

  • Membrane protein solubility: As an integral membrane protein, cytochrome b6 is hydrophobic and tends to aggregate when expressed in heterologous systems.

    • Solution: Use of specialized E. coli strains designed for membrane protein expression (C41, C43), and optimization of growth conditions (lower temperature, reduced induction levels).

    • Alternative approach: Expression as a fusion protein with solubility-enhancing tags such as MBP (maltose-binding protein).

  • Cofactor incorporation: The proper incorporation of heme cofactors is essential for functional activity.

    • Solution: Supplementation of growth media with δ-aminolevulinic acid (ALA), a heme precursor, to enhance heme synthesis during expression.

    • Alternative approach: Co-expression with genes involved in heme biosynthesis or transport.

  • Protein folding: Ensuring correct folding in a heterologous host.

    • Solution: Expression at lower temperatures (16-20°C) and use of E. coli strains with enhanced capacity for disulfide bond formation when necessary.

  • Purification without denaturation: Extracting the protein from membranes while maintaining its native conformation.

    • Solution: Use of mild detergents for solubilization (DDM, LMNG, or digitonin) followed by affinity chromatography using the attached tag.

    • Additional step: Size exclusion chromatography to ensure homogeneity and remove aggregates.

  • Stability during storage: Preventing degradation after purification.

    • Solution: Formulation in a stabilizing buffer with glycerol (as indicated in the provided storage recommendations), and storage at appropriate temperatures (-20°C/-80°C) .

For functional studies, researchers should verify the integrity of the purified protein using spectroscopic methods to confirm proper heme incorporation, as evidenced by characteristic absorption peaks. Additionally, reconstitution into liposomes or nanodiscs can provide a more native-like membrane environment for functional assays of electron transfer activity.

How can researchers assess the electron transfer activity of recombinant Odontella sinensis Cytochrome b6 in vitro, and what controls should be included?

Assessing the electron transfer activity of recombinant Odontella sinensis Cytochrome b6 in vitro requires specialized techniques that simulate its native function within the photosynthetic electron transport chain. Here is a methodological approach for such assessment:

  • Spectrophotometric redox assays:

    • Monitor the reduction and oxidation of the cytochrome b6 hemes using UV-visible spectroscopy.

    • Track absorbance changes at specific wavelengths (typically around 560 nm for b-type hemes).

    • Use artificial electron donors (such as reduced decylplastoquinone) and acceptors (such as oxidized plastocyanin or suitable analogues).

  • Reconstitution systems:

    • Reconstitute the purified protein into liposomes or nanodiscs to provide a membrane environment.

    • For complete functional studies, co-reconstitute with other components of the cytochrome b6/f complex, particularly cytochrome f (petA) and the Rieske iron-sulfur protein (petC).

    • Measure proton pumping across the liposomal membrane using pH-sensitive fluorescent dyes.

  • Electrochemical methods:

    • Employ protein film voltammetry to directly measure electron transfer rates.

    • Use modified electrodes that can interact with the protein's redox centers.

Essential controls for these experiments should include:

  • Negative controls:

    • Heat-denatured protein samples to confirm that observed activities require properly folded protein.

    • Samples lacking key substrates or cofactors to establish baseline measurements.

    • Experiments with known inhibitors of cytochrome b6/f activity (e.g., DBMIB, DNP-INT).

  • Positive controls:

    • Parallel experiments with well-characterized cytochrome b6 from model organisms (e.g., spinach or cyanobacteria).

    • Commercial cytochrome b6/f complex preparations when available.

  • Technical validations:

    • Verification of heme content using pyridine hemochrome assays.

    • Confirmation of protein integrity before and after activity assays using gel electrophoresis.

    • Spectroscopic confirmation of redox state changes during reactions.

Data analysis should include calculation of electron transfer rates, determination of kinetic parameters (Km, Vmax), and comparison with literature values for cytochrome b6 activity from other organisms. The methodological approach should account for the protein's natural role as part of a larger protein complex, and interpretations should consider this context when evaluating isolated protein activity .

What insights can comparative genomic analysis of the petB gene across different photosynthetic organisms provide for evolutionary studies?

Comparative genomic analysis of the petB gene across diverse photosynthetic organisms offers valuable insights into the evolution of photosynthetic machinery and chloroplast genomes. The petB gene, encoding cytochrome b6, is highly conserved due to its essential role in photosynthetic electron transport, making it an excellent marker for evolutionary studies.

From the search results, we can observe several key evolutionary patterns:

  • Conservation of gene clusters: The organization of cytochrome b6/f complex genes shows remarkable conservation across diverse photosynthetic lineages. For example, gene clusters such as petA-petL-petG are preserved in multiple organisms, suggesting evolutionary pressure to maintain these functional units. This conservation extends across primary endosymbiotic events that gave rise to different plastid lineages .

  • Gene partitioning patterns: Analysis of chloroplast genomes reveals striking similarities in the patterns of gene partitioning between diverse photosynthetic organisms. As shown in the comparative data, genes in the smallest segment delimited by rRNA operons in organisms like Cyanophora and Guillardia have homologs in the same genomic region in Nephroselmis and land plants. This suggests a deep evolutionary conservation of chloroplast genome organization despite significant divergence times .

  • Sequence conservation vs. genome rearrangements: While the sequence of petB shows high conservation reflecting functional constraints, the surrounding genomic context can vary due to rearrangements during chloroplast genome evolution. For instance, gene order has been scrambled in some lineages while preserving functional gene clusters.

  • Evidence for horizontal gene transfer: Comparative analysis can reveal potential instances of horizontal gene transfer or convergent evolution in the cytochrome b6/f complex genes.

This table illustrates the presence of selected genes across different photosynthetic organisms, demonstrating evolutionary patterns:

GeneCyanophoraGuillardiaOdontellaNephroselmisMarchantiaNicotiana
ccsA
chlL
chlN
ndhA
ndhD
psaC

In this table, ● indicates gene presence in the respective organism. The pattern shows that some genes (like ccsA and psaC) are universally conserved, while others show lineage-specific distribution patterns that reflect evolutionary history .

Methodologically, researchers studying petB evolution should employ multiple sequence alignment tools to identify conserved domains and variable regions, construct phylogenetic trees using both maximum likelihood and Bayesian approaches, and integrate these analyses with data on genome structure and organization to develop comprehensive models of chloroplast genome evolution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.