Recombinant Odontella sinensis Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
ycf4; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-181
Protein Length
full length protein
Species
Odontella sinensis (Marine centric diatom) (Biddulphia sinensis)
Target Names
ycf4
Target Protein Sequence
MQKEIRRDDIIGSRRFSNYFWAVFLCSGGISFLLAGISSYFKINFLPFANPKELAFIPQG LVMSFYGTLSIALAIYILGTLFWDIGSGYNEYNKVENLVKIVRKGFPGKNREILLTYPLT NIRAIGIKISEGLNPKRSIYLCLKDERQIPLTPVQQPNSISNLEEEAAELAKFLDLKLEN L
Uniprot No.

Target Background

Function

Appears essential for the assembly of the photosystem I complex.

Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the primary function of Ycf4 protein in photosynthetic organisms?

Ycf4 is a thylakoid membrane protein that plays a critical role in the assembly of Photosystem I (PSI). Research evidence demonstrates that Ycf4 functions as a scaffold protein during PSI biogenesis. Studies in Chlamydomonas reinhardtii have shown that Ycf4 stabilizes an intermediate subcomplex consisting of the PsaAB heterodimer and the three stromal subunits PsaCDE, and facilitates the addition of the PsaF subunit to this subcomplex . Biochemical analyses have revealed that although Ycf4 is not stably associated with mature PSI complexes, it is essential for their assembly and accumulation in thylakoid membranes .

The functional significance of Ycf4 varies among photosynthetic organisms:

  • In Chlamydomonas reinhardtii: Knockout mutants are unable to grow photoautotrophically and are deficient in PSI activity

  • In cyanobacteria (Synechocystis): Mutants can maintain functional PSI at reduced levels

  • In higher plants (tobacco): Complete knockout mutants cannot survive photoautotrophically, while partial knockouts show reduced but not eliminated PSI assembly

  • How is the Ycf4 protein structurally organized?

The Ycf4 protein contains distinct structural domains with specific functions:

  • N-terminal region: Contains two putative transmembrane α-helices that anchor the protein to the thylakoid membrane

  • Central hydrophilic domain: Contains highly conserved residues including R120, E179, and E181 that are critical for function

  • C-terminal region: Important for protein-protein interactions as revealed by in silico studies

The protein's size varies across species:

  • In most photosynthetic organisms: 184-185 amino acids

  • In some legumes (soybean, Lotus japonicus): Expanded to approximately 200 residues

  • In Lathyrus species: Dramatically expanded to 340 residues in some species

Despite being membrane-associated, biochemical studies have shown that Ycf4 is an extrinsic membrane protein that can be released from thylakoid membranes by treatment with alkali or chaotropic agents .

  • How conserved is the Ycf4 protein sequence across different photosynthetic organisms?

Ycf4 shows significant sequence conservation across diverse photosynthetic lineages, though with varying degrees of identity:

Organism comparisonSequence identity
C. reinhardtii vs. land plants43.2-48.6%
C. reinhardtii vs. Euglena gracilis41.3%
C. reinhardtii vs. Odontella sinensis47.5%
C. reinhardtii vs. Cyanophora paradoxa49.7%
C. reinhardtii vs. Porphyra purpurea52.2%
C. reinhardtii vs. Synechocystis45.8%

Interestingly, in some legume species, particularly in the genus Lathyrus, Ycf4 shows an accelerated evolution rate. The protein sequence divergence between Lathyrus species (31% identity between L. palustris and L. cirrhosus) exceeds that between tobacco and the cyanobacterium Synechocystis (45% identity) . This suggests that Ycf4 has been subjected to a localized hypermutation phenomenon in these species, with both accelerated sequence evolution and gene losses observed.

Advanced Research Questions

  • What experimental approaches have been used to characterize the Ycf4-containing complex?

Researchers have employed multiple complementary approaches to characterize the Ycf4-containing complex:

Biochemical Purification Techniques:

  • Tandem affinity purification (TAP) tagging of Ycf4 followed by two-step affinity column chromatography

  • Sucrose gradient ultracentrifugation and ion exchange column chromatography for complex isolation

  • Western blot analysis with antibodies against PSI subunits to identify complex components

Mass Spectrometry Analysis:

  • Liquid chromatography-tandem mass spectrometry (LC-MS/MS) to identify proteins associated with the Ycf4 complex, revealing association with PSI subunits (PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF) and the opsin-related protein COP2

Structural Visualization:

  • Electron microscopy and single particle analysis showing that the Ycf4-containing complex forms large structures measuring 285 × 185 Å

Functional Characterization:

  • Pulse-chase protein labeling experiments demonstrating that PSI polypeptides associated with the Ycf4 complex are newly synthesized and partially assembled

  • RNA interference to study the role of associated proteins (like COP2) in complex stability

These complementary approaches have revealed that the Ycf4 complex is >1500 kD in size and serves as a scaffold for PSI assembly.

  • How do mutations in conserved residues affect Ycf4 function?

Site-directed mutagenesis studies have identified several key residues critical for Ycf4 function and stability:

R120 Mutations:

  • R120A and R120Q mutations significantly reduce Ycf4 protein stability (reduced to 20% of wild-type level in logarithmic growth phase and almost none in stationary phase)

  • Protein degradation experiments with chloramphenicol showed increased instability of mutant Ycf4 proteins

  • Interestingly, despite low Ycf4 levels, PSI accumulation remained at wild-type levels, suggesting that R120 is primarily important for Ycf4 stability but not directly involved in PSI assembly

E179 and E181 Mutations:

  • E179Q and E181Q substitutions had minimal effects on Ycf4 stability or function

  • E179A reduced Ycf4 accumulation to 50% of wild-type levels but did not impair PSI accumulation

  • E181A reduced Ycf4 accumulation to 30% of wild-type levels and decreased PSI accumulation by 60%

These findings revealed that:

  • Wild-type cells accumulate approximately 5-fold more Ycf4 than required for normal PSI complex synthesis under laboratory conditions

  • E181 plays a more critical role in PSI assembly than E179

  • The hydrophilic domain of Ycf4 contains residues important for both protein stability and functional activity

  • What is the evolutionary significance of the accelerated mutation rate in Ycf4 observed in some legume species?

The accelerated evolution of Ycf4 in legumes represents a rare case of localized hypermutation within a genome and has significant evolutionary implications:

Mutation Rate Heterogeneity:

  • In Lathyrus species, the region containing Ycf4 shows at least a 20-fold higher mutation rate compared to the rest of the chloroplast genome

  • This hypermutation is sharply localized to a ~1500 bp region extending through the accD-ycf4 spacer and most of the ycf4 gene itself

  • The phenomenon violates the common assumption that point mutation rates are approximately constant throughout a genome

Evolutionary Consequences:

  • Gene loss: Ycf4 has been lost from the chloroplast genome in Lathyrus odoratus and separately in three other groups of legumes

  • Protein size variation: Ycf4 has expanded dramatically in size in some Lathyrus species, reaching 340 amino acids compared to the typical 184-185 residues

  • Minisatellite formation: The region shows increased formation and turnover of tandem repeat sequences

Despite this extreme sequence divergence, Ycf4 appears to remain functional in species where it is intact, as evidenced by:

  • Conservation of key C-terminal residues that are also conserved in other photosynthetic organisms

  • Lower nonsynonymous than synonymous substitution rates (dN/dS < 1), indicating purifying selection

This unusual evolutionary pattern suggests that hypermutation may be driving both accelerated protein evolution and nuclear relocation of plastid genes.

  • How does complete versus partial knockout of Ycf4 affect photosystem assembly?

Research comparing complete versus partial knockout of Ycf4 has revealed important insights about the functional domains of this protein:

Complete Knockout Effects:

  • In Chlamydomonas reinhardtii: Complete disruption prevents photoautotrophic growth and PSI accumulation

  • In tobacco: Complete removal of all 184 amino acids prevents photoautotrophic growth, causing plants to develop a light green phenotype that turns pale yellow with age

  • Ultrastructural studies show significant chloroplast abnormalities including altered shape, size, and grana stacking in complete knockouts

Partial Knockout Effects:

  • In tobacco: Removal of only the N-terminal 93 amino acids (while leaving the C-terminal 91 amino acids intact) allows photoautotrophic growth despite reduced PSI levels

  • In silico protein-protein interaction studies revealed that the C-terminus (91 aa) of YCF4 is particularly important for interactions with other chloroplast proteins

Transcriptome Analysis:

These findings suggest that Ycf4 has functions beyond PSI assembly, potentially in regulating plastid gene expression, and that the C-terminal domain plays a particularly critical role in protein function.

Methodological Questions

  • What are the recommended approaches for expressing and purifying recombinant Odontella sinensis Ycf4?

For successful expression and purification of recombinant Odontella sinensis Ycf4, researchers should consider the following methodological approaches:

Expression System Selection:

  • E. coli expression systems are commonly used for recombinant Ycf4 expression, as demonstrated with other Ycf4 proteins

  • For membrane proteins like Ycf4 that contain transmembrane domains, consider using expression strains optimized for membrane protein production (e.g., C41(DE3), C43(DE3) or Lemo21(DE3))

Vector Design Considerations:

  • Include an affinity tag (typically His-tag) at either the N-terminus or C-terminus to facilitate purification

  • Consider the full sequence length (for Odontella sinensis Ycf4) or optimized constructs focusing on the hydrophilic domains if expression of the full-length protein proves challenging

  • Codon optimization for E. coli may improve expression levels

Optimal Expression Conditions:

  • Lower induction temperatures (16-20°C) often improve membrane protein folding

  • IPTG concentration should be optimized (typically 0.1-0.5 mM)

  • Extended expression times (overnight) at lower temperatures may increase yield of properly folded protein

Purification Strategy:

  • Cell lysis: Sonication or high-pressure homogenization in buffer containing mild detergents

  • Membrane protein extraction: Use mild detergents (DDM, LDAO, or OG) to solubilize the protein

  • Affinity chromatography: Ni-NTA for His-tagged proteins

  • Size exclusion chromatography: To obtain pure, monodisperse protein

  • Consider buffer optimization with glycerol (5-10%) to improve stability

Storage Recommendations:

  • Add 5-50% glycerol to the final purified protein

  • Store in small aliquots at -80°C to avoid repeated freeze-thaw cycles

  • For short-term storage, keep working aliquots at 4°C for up to one week

  • What techniques are most effective for studying Ycf4-protein interactions during PSI assembly?

Several complementary techniques have proven effective for investigating Ycf4 interactions during PSI assembly:

Affinity-Based Methods:

  • Tandem affinity purification (TAP) tagging: Successfully used to identify proteins associated with Ycf4 in Chlamydomonas reinhardtii

  • Co-immunoprecipitation (Co-IP): Using antibodies against Ycf4 or potential interaction partners

  • Pull-down assays: Using recombinant tagged Ycf4 to identify binding partners

Biochemical Fractionation:

  • Sucrose gradient ultracentrifugation: Effective for separating protein complexes based on size and density

  • Blue native polyacrylamide gel electrophoresis (BN-PAGE): For analyzing intact protein complexes

  • Ion exchange chromatography: Used successfully to purify Ycf4 complexes

Protein-Protein Interaction Visualization:

  • In situ techniques such as proximity ligation assay (PLA)

  • Fluorescence resonance energy transfer (FRET) with fluorescently labeled proteins

  • Bimolecular fluorescence complementation (BiFC) for in vivo interaction studies

Functional Characterization:

  • Pulse-chase protein labeling: To track newly synthesized PSI components associating with Ycf4

  • Site-directed mutagenesis of conserved residues: To identify amino acids critical for protein interactions

  • Protein crosslinking followed by mass spectrometry: To map interaction interfaces

In Silico Approaches:

  • Protein-protein docking simulations

  • Sequence-based prediction of interaction sites

  • Evolutionary coupling analysis to identify co-evolving residues potentially involved in interactions

These techniques have collectively revealed that Ycf4 forms a large complex (>1500 kD) that acts as a scaffold for PSI assembly, interacting with newly synthesized PSI subunits including PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF, as well as other proteins like COP2 .

  • How can the impact of Ycf4 mutations on photosystem function be effectively measured?

To comprehensively evaluate the impact of Ycf4 mutations on photosystem function, researchers should employ a multi-parameter approach:

Physiological Parameters:

  • Photoautotrophic growth rate comparison: Cultivate plants/algae under controlled light conditions (40-80 µE m⁻² s⁻¹ for sensitive mutants)

  • Chlorophyll content quantification: Spectrophotometric measurement of extracted chlorophyll

  • Photosynthetic rate (A): Using gas exchange measurements with infrared gas analyzers

  • Other physiological parameters: Transpiration rate (E), stomatal conductance (gs), sub-stomatal CO₂ (Ci)

Biophysical Measurements:

  • Chlorophyll fluorescence analysis: Measure Fv/Fm ratio to assess PSII maximum quantum efficiency

  • P700 oxidation kinetics: To specifically evaluate PSI function

  • Fluorescence induction kinetics of dark-adapted cells: To assess electron transport

  • 77K fluorescence emission spectra: To evaluate energy distribution between photosystems

Biochemical Assays:

  • Immunoblot analysis: Quantify accumulation of PSI subunits (PsaA, PsaB, PsaC, etc.)

  • Blue native gel electrophoresis: Assess assembly state of photosynthetic complexes

  • Thylakoid membrane isolation and photosystem activity assays

  • Pulse-chase protein labeling: To track synthesis and turnover of photosystem components

Ultrastructural Analysis:

  • Transmission electron microscopy (TEM): Examine chloroplast ultrastructure, including thylakoid membrane organization and grana stacking

  • Single particle analysis: For higher resolution structural studies of isolated complexes

Transcriptional Analysis:

  • RNA blot hybridizations: To assess transcript levels of photosystem genes

  • Transcriptome analysis: To identify changes in expression of photosynthesis-related genes and potential compensatory responses

Published research has shown that these methods can effectively distinguish between mutations that affect Ycf4 stability versus those that directly impact its function in PSI assembly, providing insights into structure-function relationships in this important protein.

  • What are the critical factors to consider when designing site-directed mutagenesis experiments for Ycf4?

When designing site-directed mutagenesis experiments to study Ycf4 function, researchers should consider several critical factors:

Target Residue Selection:

  • Focus on highly conserved amino acids across phylogenetically diverse species (e.g., R120, E179, E181 in Chlamydomonas reinhardtii)

  • Consider charged residues in the hydrophilic domain that might be involved in protein-protein interactions

  • Evaluate residues in the transmembrane domains that could be important for membrane integration

  • Target residues identified through comparative sequence analysis as having high conservation scores

Mutation Strategy:

  • Conservative substitutions: Replace amino acids with those of similar properties to test the importance of specific side chain features

  • Non-conservative substitutions: Replace with amino acids of different properties to disrupt function

  • Alanine scanning: Systematically replace residues with alanine to identify functional regions

  • Domain deletion: Remove entire functional domains to assess their contribution

Experimental Examples:
Previous successful approaches included:

  • Substituting charged residues (R120, E179, E181) with uncharged amino acids (A or Q)

  • Replacing the entire gene with a selectable marker cassette (aadA) to generate complete knockouts

  • Partial gene deletions to study domain-specific functions

Control Considerations:

  • Include multiple mutation types for each residue (e.g., both R120A and R120Q)

  • Generate control mutations in non-conserved residues

  • Create revertant strains to confirm phenotypes are due to specific mutations

  • Consider complementation experiments by expressing wild-type Ycf4 in mutant backgrounds

Phenotypic Analysis:

  • Assess protein stability using immunoblot analysis and protein degradation assays

  • Evaluate PSI accumulation and function using biochemical and biophysical methods

  • Determine growth phenotypes under different light intensities and carbon sources

  • Examine chloroplast ultrastructure using transmission electron microscopy

Previous research has revealed that mutations can have distinct effects on Ycf4 stability versus function, highlighting the importance of comprehensive phenotypic analysis.

Supporting Data Table

  • What is the relationship between Ycf4 sequence conservation and function across different photosynthetic organisms?

The relationship between Ycf4 sequence conservation and function varies significantly across photosynthetic lineages, with important implications for understanding protein evolution and function:

OrganismYcf4 Size (aa)Essential for PSI AssemblyEssential for Photoautotrophic GrowthKey Findings
Chlamydomonas reinhardtii197YesYesComplete knockout prevents PSI accumulation and photoautotrophic growth
Synechocystis sp. PCC 6803≈184PartiallyNoMutants accumulate functional PSI at reduced levels
Tobacco (Nicotiana tabacum) - complete knockout184YesYesComplete removal prevents photoautotrophic growth
Tobacco - partial knockout (N-terminal 93 aa)91 aa remainingPartiallyNoReduced but not eliminated PSI assembly
Lathyrus speciesUp to 340Likely yesUnknownExtreme sequence divergence but evidence of purifying selection
Lathyrus odoratusLostN/AN/AGene completely lost from chloroplast genome
Pisum sativum (pea)LostN/AN/AGene lost from chloroplast genome
Odontella sinensis≈184UnknownUnknownSequence shows 47.5% identity with C. reinhardtii Ycf4

This comparative analysis reveals several important patterns:

  • Functional Conservation Despite Sequence Divergence: Despite varying levels of sequence identity (41-52%), Ycf4 maintains its role in PSI assembly across diverse photosynthetic lineages

  • Differential Essentiality: The requirement for Ycf4 differs between organisms - essential in Chlamydomonas and tobacco (complete knockout), but not in cyanobacteria or tobacco (partial knockout)

  • Evolutionary Plasticity: The chloroplast ycf4 gene has been completely lost in several legume lineages, suggesting possible functional replacement by nuclear genes or alternative assembly mechanisms

  • Structure-Function Relationships: The C-terminal portion appears particularly important for function, as evidenced by the difference between complete and partial tobacco knockouts

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.