Recombinant Odontella sinensis Photosystem I reaction center subunit XI (psaL)

Shipped with Ice Packs
In Stock

Description

Production and Characterization

Recombinant psaL is produced via heterologous expression systems, primarily in E. coli, yeast, or cell-free platforms. Key production parameters include:

ParameterDetails
Host SystemsE. coli (most common), yeast, baculovirus, mammalian cells .
Purity≥85% as determined by SDS-PAGE .
TagsN-terminal His-tag (common for purification) .
Expression RegionFull-length (1–145 amino acids) .
Storage ConditionsTris-based buffer with 50% glycerol, stored at -20°C .

The protein’s recombinant nature ensures reproducibility and scalability for biochemical studies.

Functional Insights

Functional studies on homologous psaL proteins (e.g., in Synechocystis) reveal nuanced roles:

Study FindingsImplications
Mutant AnalysisDeletion of psaL in Synechocystis caused no significant growth defects under normal conditions .
Stress ResponseMutants grew faster than wild-type under glucose supplementation and PSII inhibition, suggesting psaL’s role in stress adaptation .
Electron TransferAltered P700 re-reduction kinetics in mutants indicate psaL’s involvement in electron transfer stability .

These studies suggest psaL is dispensable under optimal conditions but may modulate PSI activity during stress.

Applications

The recombinant protein is utilized in:

ApplicationDetails
ELISA KitsUsed for detecting psaL in Odontella sinensis or related species .
Structural StudiesHis-tagged versions enable X-ray crystallography or NMR studies .
Functional AssaysInvestigating PSI subunit interactions and electron transfer mechanisms.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
psaL; Photosystem I reaction center subunit XI; PSI subunit V; PSI-L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-150
Protein Length
full length protein
Species
Odontella sinensis (Marine centric diatom) (Biddulphia sinensis)
Target Names
psaL
Target Protein Sequence
MANFIKPYNDDPFVGHLATPITSSSITRAILKNLPAYRFGLTPLLRGLEIGLAHGYFLMG PFVKLGPLRNSDIALFSGFLSTIGLILILTLGLTIYGVAAFGQGQTTENSNDLQTKKAWD QFKGGFFVGACGSAGFALICLSSIPAFTIS
Uniprot No.

Target Background

Protein Families
PsaL family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How does psaL contribute to Photosystem I function and assembly?

PsaL plays several essential roles in Photosystem I:

What experimental approaches are recommended for studying recombinant psaL function?

When investigating recombinant Odontella sinensis psaL function, researchers should consider the following methodological approaches:

  • Expression system selection: Choose an expression system that maintains proper protein folding and post-translational modifications. For membrane proteins like psaL, specialized expression systems may be required .

  • Protein characterization protocol:

    • Verify protein purity using SDS-PAGE and Western blotting

    • Confirm structural integrity through circular dichroism spectroscopy

    • Assess oligomeric state via size-exclusion chromatography

    • Verify functional activity through reconstitution assays

  • Storage and handling: Store purified recombinant psaL at -20°C for short-term use, or -80°C for extended storage to maintain protein stability. Avoid repeated freeze-thaw cycles that may compromise protein integrity .

  • Functional reconstitution: Test the ability of recombinant psaL to incorporate into PSI complexes using reconstitution experiments with isolated PSI components.

  • Activity assays: Develop specific assays to measure the contribution of psaL to electron transfer rates, complex stability, or interaction with other PSI subunits.

How can researchers evaluate potential differences between recombinant and native psaL proteins?

Evaluating differences between recombinant and native psaL requires a multi-faceted experimental approach:

  • Comparative structural analysis:

    • Perform high-resolution structural comparisons using techniques such as X-ray crystallography or cryo-electron microscopy

    • Compare secondary structure profiles using circular dichroism spectroscopy

    • Analyze thermal stability profiles to detect structural differences

  • Post-translational modification mapping:

    • Use mass spectrometry to identify and quantify post-translational modifications

    • Compare modification patterns between recombinant and native proteins

    • Assess the impact of modifications on protein function

  • Functional activity comparison:

    • Develop reconstitution assays with isolated PSI components

    • Compare electron transfer rates and efficiency

    • Evaluate binding affinity to other PSI subunits

  • In vivo complementation studies:

    • Express recombinant psaL in psaL-deficient systems

    • Quantify restoration of PSI function and assembly

    • Compare growth rates and photosynthetic efficiency

ParameterNative psaLRecombinant psaLAnalytical Method
Secondary structureReference profileMay show subtle differencesCircular dichroism spectroscopy
Post-translational modificationsComplete native patternMay lack specific modificationsMass spectrometry
Thermal stabilityTypically higherOften slightly lowerDifferential scanning calorimetry
Protein-protein interactionsFull complementMay show altered binding kineticsSurface plasmon resonance
Assembly competenceCompleteVariable depending on expression systemReconstitution assays

What experimental design considerations are crucial when studying psaL's role in PSI assembly?

When investigating psaL's role in PSI assembly, researchers should implement a robust experimental design that addresses the following considerations:

  • Control selection: Include appropriate positive and negative controls in all experiments. For assembly studies, use wild-type PSI complexes as positive controls and PSI preparations lacking psaL as negative controls .

  • Variable identification and management:

    • Clearly define dependent and independent variables

    • Control for confounding variables such as temperature, light conditions, and ionic strength

    • Use standardized protocols to minimize experimental variability

  • Quantitative measurements:

    • Develop quantitative metrics for PSI assembly efficiency

    • Use multiple complementary techniques to measure the same outcome

    • Establish reliable baseline measurements before experimental manipulations

  • Genetic manipulation approaches:

    • Design targeted mutations in conserved psaL domains

    • Use site-directed mutagenesis to create specific amino acid substitutions

    • Develop conditional expression systems to control psaL levels

  • Time-resolved analysis:

    • Monitor PSI assembly kinetics at defined time points

    • Track accumulation of assembly intermediates

    • Correlate psaL expression with complex formation rates

Researchers should apply the Rubric for Experimental Design (RED) framework to ensure methodological rigor, accounting for variables, appropriate measurements, and variability control as outlined in established protocols for photosynthetic complex analysis .

How should researchers approach contradictory findings in psaL functional studies?

When confronted with contradictory findings in psaL functional studies, researchers should employ the following methodological approach:

  • Systematic comparison of methodologies:

    • Compare experimental conditions, including temperature, pH, and ionic strength

    • Evaluate differences in protein preparation methods

    • Assess variability in measurement techniques and instrumentation

    • Consider differences in genetic backgrounds or expression systems

  • Data validation through complementary techniques:

    • Verify key findings using alternative experimental approaches

    • Apply multiple analytical methods to the same biological question

    • Conduct parallel studies in different model systems

  • Statistical reanalysis:

    • Perform meta-analysis of contradictory datasets

    • Reassess statistical power and sample sizes

    • Evaluate potential sources of systematic error

    • Consider statistical approaches for reconciling divergent results

  • Collaborative verification:

    • Establish collaborations with laboratories reporting contradictory findings

    • Develop standardized protocols for cross-laboratory validation

    • Perform blind analyses of samples prepared by different research groups

  • Publication of reconciliation studies:

    • Explicitly address contradictions in the literature

    • Present unified models that accommodate apparently conflicting results

    • Highlight remaining uncertainties and propose experiments to resolve them

This methodological framework aligns with established rubrics for experimental design in biological research and provides a systematic approach to resolving contradictions in the scientific literature .

What controls should be included when working with recombinant Odontella sinensis psaL?

Robust experimental design for recombinant psaL studies requires the following controls:

  • Positive controls:

    • Native PSI complexes isolated from Odontella sinensis

    • Well-characterized recombinant psaL from model organisms

    • Synthetic peptides corresponding to functional domains of psaL

  • Negative controls:

    • Expression vector without psaL insert

    • Heat-denatured recombinant psaL

    • PSI complexes with psaL genetically deleted or inactivated

  • Expression system controls:

    • Host cells transformed with empty vector

    • Expression of non-relevant control protein

    • Time-course sampling to monitor expression dynamics

  • Purification controls:

    • Column flow-through fractions

    • Mock purification from non-transformed cells

    • Purification of known control proteins

  • Storage and handling controls:

    • Freshly prepared protein versus stored samples

    • Different storage conditions (temperature, buffer composition)

    • Samples subjected to multiple freeze-thaw cycles

Implementing this comprehensive control strategy addresses the five key areas of experimental difficulty identified in the literature: subject properties, manipulated variables, outcome measurement, variability control, and appropriate inference scope .

How can researchers detect and measure PSI assembly defects related to psaL dysfunction?

Detection and quantification of PSI assembly defects requires a multi-modal analytical approach:

  • Biochemical analysis techniques:

    • Blue-native PAGE to assess complex integrity and subunit composition

    • Sucrose gradient ultracentrifugation to separate assembly intermediates

    • Size-exclusion chromatography to quantify complex formation

    • Co-immunoprecipitation to detect subunit interactions

  • Spectroscopic methods:

    • Absorption spectroscopy to measure chlorophyll binding

    • Fluorescence emission spectroscopy to assess energy transfer efficiency

    • Circular dichroism to evaluate protein secondary structure

    • EPR spectroscopy to examine iron-sulfur cluster incorporation

  • Functional measurements:

    • P700 photooxidation kinetics

    • Electron transfer rates from plastocyanin to ferredoxin

    • Oxygen evolution and consumption rates

    • PSI-dependent cyclic electron flow

  • Structural analysis:

    • Electron microscopy to visualize complex formation

    • Cross-linking mass spectrometry to map protein interactions

    • Hydrogen-deuterium exchange to probe structural dynamics

  • In vivo phenotyping:

    • Growth rate under different light conditions

    • Photosensitivity assays

    • Chlorophyll fluorescence imaging

    • Reactive oxygen species production

Assembly ParameterMeasurement TechniqueExpected Outcome with psaL Dysfunction
PSI complex integrityBlue-native PAGEReduced abundance of intact PSI; appearance of subcomplexes
Subunit stoichiometryMass spectrometryAltered ratios of PSI subunits
Energy transfer efficiencyTime-resolved fluorescenceIncreased chlorophyll fluorescence; altered decay kinetics
Electron transfer rateFlash photolysisReduced P700+ reduction rate
ROS productionEPR spin-trappingIncreased superoxide/singlet oxygen formation

What methodological approaches should be used to study psaL interactions with other PSI subunits?

Investigation of psaL's interactions with other PSI subunits requires specialized methodologies:

  • In vitro binding assays:

    • Surface plasmon resonance to measure binding kinetics

    • Isothermal titration calorimetry for thermodynamic parameters

    • Microscale thermophoresis for affinity measurements

    • FRET-based assays for proximity detection

  • Cross-linking strategies:

    • Chemical cross-linking coupled with mass spectrometry

    • Photo-activatable cross-linkers for capturing transient interactions

    • Site-specific cross-linking at engineered cysteine residues

    • In vivo cross-linking followed by co-immunoprecipitation

  • Genetic approaches:

    • Yeast two-hybrid or split-ubiquitin assays

    • Suppressor mutation analysis

    • Synthetic genetic array analysis

    • Conditional expression systems

  • Structural biology techniques:

    • X-ray crystallography of co-purified complexes

    • Cryo-electron microscopy of intact PSI

    • NMR analysis of interface regions

    • Computational modeling and docking

  • In situ visualization:

    • FRET microscopy in live cells

    • Fluorescence correlation spectroscopy

    • Single-molecule tracking

    • Super-resolution microscopy

When implementing these methodologies, researchers should incorporate the experimental design principles outlined in the Rubric for Experimental Design (RED), particularly addressing the measurement of outcomes and accounting for variability .

How should researchers interpret functional differences observed between in vitro and in vivo studies of psaL?

Reconciling differences between in vitro and in vivo observations requires careful methodological consideration:

  • Systematic evaluation of experimental contexts:

    • Compare protein concentrations, which are typically higher in vitro

    • Assess the impact of cellular compartmentalization absent in vitro

    • Consider the role of other cellular components present in vivo

    • Evaluate the influence of physiological regulatory mechanisms

  • Bridging approaches:

    • Develop reconstituted membrane systems or liposomes

    • Use permeabilized cells or isolated thylakoids

    • Create minimal in vitro systems with defined components

    • Perform in organello experiments with isolated chloroplasts

  • Validation strategies:

    • Design experiments that can be performed both in vitro and in vivo

    • Establish quantitative relationships between in vitro parameters and in vivo functions

    • Develop computational models to predict in vivo behavior from in vitro data

    • Use genetic complementation to validate in vitro findings

  • Data integration framework:

    • Construct hierarchical models incorporating data from multiple scales

    • Apply systems biology approaches to integrate diverse datasets

    • Develop testable predictions that span in vitro and in vivo contexts

    • Use Bayesian methods to update models as new data become available

This comprehensive approach acknowledges the inherent limitations of both in vitro and in vivo methodologies while providing a framework for meaningful data interpretation across experimental contexts .

What statistical considerations are important when analyzing psaL mutant phenotypes?

Statistical analysis of psaL mutant phenotypes should address the following methodological considerations:

  • Experimental design optimization:

    • Determine appropriate sample sizes through power analysis

    • Implement randomization protocols to minimize bias

    • Use blocking designs to control for experimental batches

    • Include appropriate genetic background controls

  • Phenotypic measurement standardization:

    • Develop quantitative metrics for complex phenotypes

    • Establish clear criteria for categorical phenotypes

    • Use multiple independent measurements for each phenotype

    • Account for measurement error in statistical models

  • Statistical method selection:

    • Choose parametric or non-parametric tests based on data distribution

    • Apply appropriate multiple testing corrections

    • Consider hierarchical or mixed models for nested data

    • Use multivariate approaches for correlated phenotypes

  • Effect size interpretation:

    • Report standardized effect sizes alongside p-values

    • Consider biological significance beyond statistical significance

    • Establish thresholds for meaningful phenotypic differences

    • Compare effect sizes across different experimental conditions

  • Advanced analytical approaches:

    • Apply machine learning for complex phenotypic classification

    • Use dimensional reduction techniques for high-dimensional data

    • Implement time-series analysis for dynamic phenotypes

    • Develop network models to understand phenotypic relationships

By addressing these statistical considerations, researchers can enhance the reliability and reproducibility of their findings, in alignment with established best practices for experimental design in biological research .

What emerging technologies could advance our understanding of psaL function?

Several cutting-edge technologies hold promise for deepening our understanding of psaL function:

  • Cryo-electron tomography: This technique can visualize PSI complexes in their native cellular environment, providing insights into how psaL contributes to supramolecular organization in thylakoid membranes.

  • Single-molecule tracking: Following the movement and interactions of fluorescently labeled psaL in living cells could reveal dynamic aspects of PSI assembly and turnover.

  • Time-resolved X-ray free-electron laser crystallography: This approach could capture transient conformational changes in psaL during electron transfer events.

  • CRISPR-based screening: High-throughput mutagenesis of psaL combined with phenotypic screening could identify previously unrecognized functional domains.

  • Integrative structural biology: Combining multiple structural determination methods (X-ray crystallography, cryo-EM, NMR, mass spectrometry) could provide a more complete picture of psaL's structural dynamics.

  • Synthetic biology approaches: Engineering minimal photosynthetic systems with defined components could isolate psaL's specific contributions to PSI function.

  • Advanced computational modeling: Molecular dynamics simulations and quantum mechanical calculations could predict electron transfer pathways influenced by psaL.

Researchers implementing these technologies should adhere to rigorous experimental design principles, particularly regarding measurement validation and variability control, as outlined in established rubrics for experimental design in biological research .

How can researchers design experiments to elucidate the evolutionary significance of psaL conservation?

To investigate the evolutionary significance of psaL conservation, researchers should implement the following experimental design strategy:

  • Comparative genomic analysis:

    • Construct comprehensive phylogenetic trees of psaL sequences

    • Identify conserved domains and residues across diverse photosynthetic organisms

    • Calculate selection pressures on different regions of the protein

    • Map conservation patterns onto structural models

  • Experimental evolution approaches:

    • Subject photosynthetic organisms to varied selection pressures

    • Monitor genetic changes in psaL over multiple generations

    • Perform competition experiments between wild-type and mutant strains

    • Create synthetic psaL variants with ancestral or predicted sequences

  • Functional complementation studies:

    • Express psaL genes from diverse organisms in a common genetic background

    • Quantify the ability of heterologous psaL to restore PSI function

    • Identify functionally interchangeable and non-interchangeable regions

    • Create chimeric proteins to map functional domains

  • Structural comparison methodology:

    • Determine structures of psaL from diverse photosynthetic lineages

    • Compare interaction interfaces with other PSI subunits

    • Identify structural adaptations correlated with environmental niches

    • Model the co-evolution of psaL with interacting partners

When implementing these approaches, researchers should adhere to the experimental design principles outlined in the RED framework, particularly regarding the scope of inference appropriate for experimental findings and accounting for biological variability .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.