Recombinant Odontella sinensis Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

The CP47 chlorophyll apoprotein, encoded by the psbB gene, is an integral component of Photosystem II (PSII) in oxygenic photosynthetic organisms. In Odontella sinensis, a marine centric diatom, recombinant CP47 is produced via heterologous expression in E. coli, enabling biochemical and structural studies without native extraction challenges .

Expression and Extraction

  • Vector Design: Full-length psbB gene cloned into an E. coli-compatible vector .

  • Induction: IPTG-induced expression under a T7/lac promoter .

  • Harvesting: Cells lysed via sonication or enzymatic methods, followed by centrifugation .

Purification Steps

  1. Affinity Chromatography: His tag enables nickel-NTA column purification .

  2. Buffer Exchange: Tris/PBS-based buffer with 6% trehalose (pH 8.0) for stabilization .

  3. Lyophilization: Stored as a lyophilized powder to prolong shelf life .

Reconstitution Guidelines

  • Solubilization: Reconstitute in deionized water (0.1–1.0 mg/mL) .

  • Glycerol Addition: 5–50% glycerol recommended for long-term storage .

Research Applications

  • ELISA Development: Used as an antigen in immunological assays to study PSII components .

  • Photosynthesis Studies: Enables mutational analysis to probe chlorophyll-protein interactions .

  • Biophysical Analyses: Crystallization trials for resolving PSII architecture at atomic resolution .

Comparative Insights

While Odontella sinensis CP47 shares >80% sequence homology with spinach (Spinacia oleracea) and Oenothera glazioviana CP47, its marine origin may confer unique adaptations to high-salinity environments .

Challenges and Considerations

  • Stability Issues: Repeated freeze-thaw cycles degrade the protein; aliquoting is essential .

  • Activity Verification: Functional assays (e.g., chlorophyll fluorescence kinetics) are required to confirm bioactivity post-reconstitution .

Future Directions

Recent advances in cryo-EM and X-ray crystallography (e.g., 6 Å resolution models of PSII) highlight opportunities to integrate recombinant CP47 into structural studies of diatom-specific photosynthesis adaptations .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will prepare your order accordingly.
Lead Time
Delivery times may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery time estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize development of the specified tag.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-509
Protein Length
full length protein
Species
Odontella sinensis (Marine centric diatom) (Biddulphia sinensis)
Target Names
psbB
Target Protein Sequence
MALPWYRVHTVVLNDPGRLIAVHLMHTALVAGWAGSMALYELAVFDPSDPVLNPMWRQGM FVMPFMTRLGITDSWGGWSITGESVSNPGIWSFEGVALSHIILSGMCFLAAIWHWVYWDL ELFRDPRTGEPALDLPKIFGIHLFLSGLLCFGFGAFHVTGLFGPGIWVSDAYGVTGKVQP VAPAWGADGFNPFNPGGIAAHHIAAGIFGIFAGIFHLTVRPPQRLYRALRMGNIETVLSS SIAAVFFAAFVTSGTMWYGAAATPIELFGPTRYQWDSGYFQQEIERQVETSVSEGLSESQ AWSRIPDKLAFYDYIGNNPAKGGLFRAGPMNKGDGIAEAWLGHPIFRDKDGRELTVRRMP AFFETFPVILVDKDGIIRADIPFRRAESKYSIEQVGVTVDFYGGKLNGQTFKDAPTVKKF ARKAQLGEVFEFDRTSLESDGVFRSSPRGWYTFGHANFALLFFFGHLWHGGRTIFRDVFT GIGAEVTEQVEFGAFQKLGDKSTKKQGAV
Uniprot No.

Target Background

Function
CP47, a chlorophyll apoprotein, is a key component of the photosystem II (PSII) core complex. It binds chlorophyll and facilitates the primary light-induced photochemical reactions of PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase. Utilizing light energy, it extracts electrons from H2O, generating O2 and a proton gradient, which subsequently drives ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the fundamental structure and function of Photosystem II CP47 chlorophyll apoprotein (psbB)?

Photosystem II CP47 chlorophyll apoprotein (psbB) functions as a core antenna protein in the Photosystem II complex. Based on comparative studies with other species, the protein exhibits several key structural features:

  • Typically contains approximately 508 amino acids (based on homologous proteins)

  • Features multiple hydrophobic regions that anchor the protein within the thylakoid membrane

  • Contains strategically positioned histidine residues that facilitate chlorophyll binding

  • Demonstrates highly conserved hydropathy patterns across photosynthetic organisms

Research has demonstrated that CP47 is essential for functional Photosystem II complexes, as interruption of the psbB gene results in complete loss of Photosystem II activity . The protein's principal function involves binding chlorophyll molecules that gather and transfer light energy to the reaction center, although it may not house the reaction center itself .

How conserved is the psbB sequence across different photosynthetic organisms?

The psbB gene and its encoded protein show remarkable conservation across diverse photosynthetic organisms, reflecting its essential function in photosynthesis. Comparative studies between cyanobacteria and higher plants have shown:

  • DNA sequence homology of approximately 68% between cyanobacterial and plant psbB genes

  • Protein sequence homology of approximately 76% at the amino acid level

  • Nearly identical hydropathy patterns, suggesting conserved membrane topology and folding

For researchers working with Odontella sinensis psbB, this conservation provides valuable comparative templates for structure-function analyses. When sequence variations do occur, they often represent adaptations to specific environmental conditions or photosynthetic strategies, making these regions particularly interesting for evolutionary and functional studies.

What expression systems are most effective for producing recombinant psbB protein?

For successful expression of recombinant psbB protein, Escherichia coli represents a well-established system, though with specific considerations:

  • E. coli has been successfully used to express recombinant psbB with N-terminal His-tags

  • Complete protein expression (full-length 1-508 amino acids) has been achieved

  • Expression requires optimization to address the hydrophobic nature of the protein

Alternative systems may include:

  • Cyanobacterial hosts for more native-like folding and processing

  • Cell-free expression systems for membrane proteins

  • Chaperone co-expression strategies to improve folding efficiency

The choice of expression system should be guided by the specific research questions and downstream applications. For structural studies requiring large quantities of protein, bacterial expression may be preferred, while functional studies might benefit from expression in photosynthetic hosts.

What purification strategies yield the highest purity and activity for recombinant psbB?

Purification of recombinant psbB typically employs affinity chromatography approaches, with specific considerations for membrane proteins:

  • His-tagged recombinant psbB can be purified using immobilized metal affinity chromatography (IMAC)

  • Detergent selection is critical for solubilization while maintaining protein integrity

  • Purification buffers should incorporate stabilizing agents such as trehalose (6%) to prevent aggregation

  • For highest purity (>90%), multiple chromatography steps may be required

After purification, lyophilization can be employed for long-term storage, with reconstitution in appropriate buffers containing glycerol (recommended at 5-50% final concentration) . Care must be taken to avoid repeated freeze-thaw cycles, which can compromise protein integrity .

How do histidine residue positions in psbB influence chlorophyll binding and functionality?

Histidine residues in CP47 play a critical role in chlorophyll binding, with significant implications for protein function:

  • Five pairs of histidine residues spaced by 13-14 amino acids have been identified in hydrophobic regions of the protein

  • These histidine pairs likely serve as ligands for chlorophyll molecules

For researchers investigating Odontella sinensis psbB, site-directed mutagenesis of these conserved histidine residues represents a powerful approach to probe chlorophyll-binding dynamics. Expected outcomes from such mutations include:

  • Altered spectral properties reflecting modified chlorophyll coordination

  • Changes in energy transfer efficiency within the Photosystem II complex

  • Potential impacts on photosynthetic electron transport rates

Experimental approaches combining mutagenesis with spectroscopic analysis (circular dichroism, fluorescence) can effectively characterize these changes, providing insights into structure-function relationships.

What regulatory mechanisms affect psbB transcript stability and translation in plastids?

The stability and translation of plastid-encoded psbB transcripts involve complex regulatory mechanisms, particularly related to translation termination:

  • psbB transcripts contain UGA stop codons that require specific release factors for proper termination

  • The nucleus-encoded AtprfB (peptide chain release factor 2) specifically recognizes UGA stop codons in plastid transcripts

  • Deficiencies in AtprfB lead to decreased stability of UGA-containing transcripts, including psbB

This regulatory relationship suggests a direct connection between translation termination efficiency and transcript stability. For researchers investigating Odontella sinensis psbB expression, considerations should include:

  • Analysis of stop codon usage in the target transcript

  • Identification and characterization of species-specific release factors

  • Potential co-regulatory relationships between nuclear and plastid gene expression

Methodological approaches might include pulse-chase experiments to measure transcript stability, polysome profiling to assess translation efficiency, and genetic manipulation of release factors to observe effects on psbB expression.

How does psbB integrate into the functional Photosystem II complex?

Assembly of psbB into the functional Photosystem II complex involves coordinated protein-protein interactions and cofactor binding:

  • CP47 serves as a core antenna protein that must properly integrate with reaction center proteins

  • The process requires correct folding of transmembrane domains within the thylakoid membrane

  • Chlorophyll molecules must be correctly positioned within the protein structure

Research approaches to study this integration process include:

  • In vitro reconstitution assays with purified components

  • Time-resolved spectroscopy to track assembly kinetics

  • Crosslinking studies to map protein-protein interaction surfaces

  • Cryo-electron microscopy to visualize assembly intermediates

For Odontella sinensis psbB research, special attention should be paid to potential species-specific assembly factors or chaperones that might facilitate the integration process under particular environmental conditions relevant to this marine diatom.

What experimental approaches can resolve contradictions in functional data between recombinant and native psbB?

Researchers may encounter discrepancies between functional data obtained from recombinant versus native psbB proteins. Methodological approaches to address these contradictions include:

  • Comparative spectroscopic analysis of pigment binding and energy transfer

  • Assessment of protein-protein interactions using proximity labeling techniques

  • Structural analysis comparing recombinant and native forms

  • Functional complementation studies in psbB-deficient systems

A systematic comparison framework should include:

ParameterNative psbBRecombinant psbBMethodological Considerations
Protein FoldingMembrane-integrated, co-translationalOften requires refoldingDetergent screening, reconstitution systems
Pigment BindingComplete chlorophyll complementMay have incomplete bindingReconstitution with purified pigments
Protein-Protein InteractionsFull PSII complex associationPotentially altered interaction surfacesCrosslinking, co-immunoprecipitation
Spectroscopic PropertiesNative energy transfer characteristicsMay show altered spectral featuresAbsorption, fluorescence, circular dichroism

Resolution of these contradictions typically requires iterative refinement of expression, purification, and reconstitution conditions to more closely mimic the native environment.

What specialized storage conditions maximize the stability of recombinant psbB?

Recombinant psbB requires specific storage conditions to maintain structural integrity and function:

  • Store lyophilized protein at -20°C to -80°C for long-term preservation

  • For working solutions, store aliquots at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles, which significantly compromise protein stability

  • Use buffer formulations containing 6% trehalose at pH 8.0

  • For reconstituted protein, add glycerol to a final concentration of 5-50%

These conditions have been optimized to preserve protein structure while preventing aggregation and denaturation. Researchers should validate stability through activity assays or spectroscopic methods before proceeding with functional experiments.

What analytical techniques best characterize the structural integrity of recombinant psbB?

Multiple complementary techniques should be employed to comprehensively characterize recombinant psbB:

  • SDS-PAGE for assessing purity and apparent molecular weight

  • Circular dichroism spectroscopy for secondary structure analysis

  • UV-visible absorption spectroscopy for chlorophyll binding assessment

  • Size exclusion chromatography for oligomeric state determination

  • Mass spectrometry for precise molecular weight verification and post-translational modification analysis

These techniques collectively provide a detailed profile of protein quality and structural integrity. For membrane proteins like psbB, additional techniques such as limited proteolysis can provide insights into proper folding and domain organization within the transmembrane regions.

How can researchers effectively design site-directed mutagenesis experiments for psbB functional studies?

Strategic approaches to site-directed mutagenesis of psbB should focus on:

  • Conserved histidine residues implicated in chlorophyll binding

  • Residues at protein-protein interaction interfaces within the PSII complex

  • Regions showing species-specific variations that may reflect adaptive differences

Experimental design should include:

  • Careful selection of amino acid substitutions (conservative vs. non-conservative)

  • Creation of mutation series to establish structure-function relationships

  • Development of appropriate functional assays to detect subtle phenotypic changes

  • Complementation studies in psbB-deficient systems to validate in vivo significance

Researchers should particularly focus on the five pairs of histidine residues that are spaced by 13-14 amino acids and located in hydrophobic regions, as these have been implicated in chlorophyll binding and are likely key to protein function .

What functional assays most effectively evaluate recombinant psbB activity?

To comprehensively assess recombinant psbB functionality, researchers should employ a combination of assays:

  • Chlorophyll binding capacity assessment through absorption and fluorescence spectroscopy

  • Energy transfer efficiency measurements using time-resolved fluorescence

  • Reconstitution into liposomes or nanodiscs for functional studies

  • Integration into Photosystem II subcomplexes and activity measurement

  • Complementation of psbB-deficient photosynthetic organisms

As demonstrated in research with other species, disruption of psbB function typically results in complete loss of Photosystem II activity , making functional complementation a particularly powerful assay system for validating recombinant protein activity.

What are the most promising future research directions for Odontella sinensis psbB studies?

Future research on Odontella sinensis psbB holds significant potential in several key areas:

  • Comparative structural biology examining adaptations specific to marine diatoms

  • Investigation of light-harvesting efficiency under variable marine light conditions

  • Exploration of psbB regulation in response to environmental stressors

  • Engineering efforts to enhance photosynthetic efficiency through targeted modifications

  • Integration of psbB studies with broader investigations of marine primary productivity

These research directions build upon the fundamental understanding of psbB structure and function while addressing questions specific to marine photosynthetic organisms. The highly conserved nature of psbB across species provides a solid framework for comparative studies , while species-specific variations offer insights into evolutionary adaptations to diverse ecological niches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.