Recombinant Odontella sinensis Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Amino Acid Sequence Highlights

The N-terminal sequence begins with MTATLERREG, while the C-terminal region contains the processing site Ala344 .

Functional Role in Photosynthesis

  • Electron transport: Mediates electron transfer from water to plastoquinone via the QB binding site .

  • Photoactivation: Requires C-terminal processing by CtpA for assembly into functional PSII complexes .

  • Oxidative stress response: The D1 protein undergoes rapid turnover under high-light stress to repair photodamage .

Comparative Analysis with Homologs

The O. sinensis D1 protein shares structural and functional similarities with homologs across photosynthetic organisms:

SpeciesC-Terminal Extension LengthRedox RegulationKey Reference
O. sinensis16 residuesThioredoxin-independent
Spinacia oleracea (Spinach)8-9 residuesThioredoxin-dependent
Synechocystis sp. PCC680315 residuesCtpA-dependent

Research Applications

  • Photosystem II assembly studies: Used to investigate CtpA protease activity and D1 protein maturation .

  • Biophysical characterization: Crystallography and spectroscopy to map electron transport pathways .

  • Stress response modeling: Evaluates photodamage repair mechanisms under varying light conditions .

Key Challenges and Innovations

  • Stability issues: The recombinant protein requires glycerol-containing buffers to prevent aggregation .

  • Functional reconstitution: Successful integration into artificial thylakoid membranes remains experimentally demanding .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Odontella sinensis (Marine centric diatom) (Biddulphia sinensis)
Target Names
psbA
Target Protein Sequence
MTATLERREGVSLWERFCAWITSTENRLYIGWFGCLMFPTLLTATSCYIIAFIAAPPVDI DGIREPVAGSLLYGNNIISGAVIPSSNAIGMHFYPIWEAASIDEWLYNGGPYQLIVLHFL LGVASYMGREWELSYRLGMRPWIFVAFSAPVAAASAVFLVYPIGQGSFSDGMPLGISGTF NFMLVFQAEHNILMHPFHMAGVAGVFGGSLFSAMHGSLVTSSLIRETTENESTNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRALHFFLAAWPVVGIWLTAMGVSTMAFNLNGF NFNQSVVDSQGRVINTWADIINRADLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H₂O, generating O₂ and a proton gradient for ATP synthesis. PSII comprises a core antenna complex for photon capture and an electron transfer chain converting photonic excitation into charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Odontella sinensis Photosystem Q(B) protein and what is its function in photosynthesis?

Odontella sinensis Photosystem Q(B) protein, also known as Photosystem II protein D1 or 32 kDa thylakoid membrane protein, is a critical component of the photosynthetic apparatus in this marine centric diatom . The protein functions within the Photosystem II (PSII) complex, specifically serving as the binding site for plastoquinone at the QB site.

This protein plays an essential role in electron transfer chain of photosynthesis, facilitating the movement of electrons from the primary quinone acceptor (QA) to the secondary quinone acceptor (QB). The protein has an EC number of 1.10.3.9, confirming its oxidoreductase activity . In its native environment, the protein is integral to the thylakoid membrane and works in conjunction with other PSII complex proteins to harness light energy and convert it to chemical energy.

How does the Odontella sinensis Photosystem Q(B) protein interact with other components of the photosynthetic apparatus?

The Odontella sinensis Photosystem Q(B) protein operates within a complex network of protein-protein interactions in the PSII complex. Evidence from studies of related photosystem components indicates that this D1 protein works in close coordination with the D2 protein (Photosystem Q(A) protein, encoded by psbD) .

Together, these proteins form the reaction center heterodimer of PSII, where they bind critical cofactors including chlorophylls, pheophytins, and quinones. The D1 protein specifically binds QB, while D2 binds QA . Research on similar photosynthetic systems suggests that various small subunits, such as PSII-X, may regulate the binding or turnover of quinones at the QB site .

Studies in the cyanobacterium Synechococcus elongatus have demonstrated that disruption of the psbX gene affects oxygen evolution supported by artificial quinones, particularly at high concentrations of 2,6-dichlorobenzoquinone or 2,6-dimethylbenzoquinone . This suggests complex functional interactions between various PSII subunits that may also be relevant to understanding the Odontella sinensis Photosystem Q(B) protein's interactions.

What are the optimal conditions for handling and storing Recombinant Odontella sinensis Photosystem Q(B) protein?

For optimal integrity and functionality of Recombinant Odontella sinensis Photosystem Q(B) protein in research applications, proper storage and handling protocols are essential. The protein is typically supplied in a Tris-based buffer with 50% glycerol, specifically optimized for this protein's stability .

Storage recommendations:

  • Store at -20°C for regular use

  • For extended storage, maintain at -20°C or -80°C

  • Avoid repeated freeze-thaw cycles, which can compromise protein integrity

  • Working aliquots can be stored at 4°C for up to one week

When designing experiments, researchers should consider:

  • Minimizing exposure to room temperature

  • Using appropriate protective additives when diluting the stock solution

  • Conducting activity assays soon after thawing to ensure functional integrity

  • Maintaining optimal pH and ionic strength in experimental buffers

What experimental approaches are most effective for studying Photosystem Q(B) protein function in vitro?

Advanced studies of Photosystem Q(B) protein function require specialized approaches to maintain the integrity of this membrane protein while assessing its activity. Based on research with similar photosystem proteins, several methodologies prove particularly valuable:

Oxygen evolution measurements represent a gold-standard approach for assessing PSII function. Researchers can employ Clark-type electrodes or oxygen-sensitive fluorescent probes to measure oxygen production during illumination of isolated PSII complexes containing the Recombinant Odontella sinensis Photosystem Q(B) protein . When supplemented with artificial electron acceptors like 2,6-dichlorobenzoquinone or 2,6-dimethylbenzoquinone, these assays can specifically probe QB site function.

Spectroscopic techniques provide detailed insights into electron transfer processes. Absorption spectroscopy, fluorescence spectroscopy, and EPR (Electron Paramagnetic Resonance) allow monitoring of redox changes and electron movement through the photosynthetic electron transport chain. Studies in related systems have employed these techniques to detect subtle changes in quinone binding and electron transfer kinetics .

For structural studies, researchers may consider:

  • Reconstitution of the protein into liposomes or nanodiscs

  • Crystallization trials for X-ray crystallography

  • Single-particle cryo-electron microscopy

These approaches have proven successful in related PSII research and may be adapted for specific investigations of the Odontella sinensis Photosystem Q(B) protein.

How can site-directed mutagenesis be utilized to investigate critical residues in Odontella sinensis Photosystem Q(B) protein?

Site-directed mutagenesis represents a powerful approach for elucidating structure-function relationships in the Photosystem Q(B) protein. Based on homology with well-studied photosystem proteins from other organisms, researchers can identify candidate residues for mutation that may be involved in:

  • Quinone binding at the QB site

  • Interactions with other PSII subunits

  • Proton transfer pathways

  • Membrane integration

The experimental approach should include:

  • Identification of conserved residues through multiple sequence alignment with homologous D1 proteins from other photosynthetic organisms

  • Generation of expression constructs containing specific mutations

  • Expression and purification of the mutant proteins

  • Functional characterization through oxygen evolution assays with artificial quinones

  • Structural assessment using spectroscopic methods

Insights from studies of the psbX gene in Synechococcus elongatus suggest that focusing on residues potentially involved in quinone binding or turnover may be particularly informative . By systematically mutating these residues and characterizing the resulting phenotypes, researchers can map the functional architecture of the Odontella sinensis Photosystem Q(B) protein.

What methods are most effective for analyzing interactions between Photosystem Q(B) protein and artificial quinones?

The interaction between Photosystem Q(B) protein and quinones is central to its function in electron transport. Research with related photosystem proteins indicates several effective methodologies for investigating these interactions:

Oxygen evolution assays provide functional readouts of quinone activity at the QB site. By varying the concentration and type of artificial quinones (such as 2,6-dichlorobenzoquinone or 2,6-dimethylbenzoquinone), researchers can generate kinetic data that reflects binding affinity and electron transfer efficiency . Studies with psbX-disrupted mutants in Synechococcus elongatus revealed concentration-dependent effects of artificial quinones, with more pronounced differences at higher quinone concentrations .

Spectroscopic approaches offer direct measurement of quinone binding and reduction kinetics:

  • UV-visible absorption spectroscopy to monitor quinone reduction

  • EPR spectroscopy to examine quinone radical formation

  • FTIR spectroscopy to probe protein-quinone interactions

Binding studies using isothermal titration calorimetry or surface plasmon resonance can provide thermodynamic and kinetic parameters for quinone interactions with purified Photosystem Q(B) protein or PSII complex preparations.

These methods, when combined, provide comprehensive insights into the mechanistic details of quinone binding and electron transfer at the QB site.

What are the challenges and solutions in expressing and purifying functional Recombinant Odontella sinensis Photosystem Q(B) protein?

Expression and purification of functional membrane proteins like the Photosystem Q(B) protein present significant challenges. Based on established protocols for similar proteins, researchers should consider:

Expression System Selection:
The choice between prokaryotic (E. coli) and eukaryotic expression systems involves important tradeoffs. While bacterial systems offer simplicity and high yields, they may lack the post-translational machinery needed for proper folding. Eukaryotic systems like yeast, insect cells, or cell-free systems may provide better environments for folding but typically yield less protein.

Solubilization Strategies:
As an integral membrane protein, the Photosystem Q(B) protein requires careful solubilization:

  • Detergent screening to identify optimal solubilization conditions

  • Consideration of amphipols, nanodiscs, or styrene-maleic acid copolymers as alternatives to detergents

  • Incorporation of stabilizing lipids during purification

Purification Challenges:
Maintaining protein stability during purification requires:

  • Multi-step chromatography (affinity, ion exchange, size exclusion)

  • Addition of specific lipids to maintain native-like environment

  • Inclusion of cofactors or quinone analogs to stabilize the protein structure

Functional Verification:
Confirming that the purified protein retains native structure and function through:

  • Oxygen evolution assays with artificial electron acceptors

  • Spectroscopic analysis of cofactor binding

  • Limited proteolysis to assess proper folding

The recombinant protein is typically stored in a Tris-based buffer containing 50% glycerol, which helps maintain stability during storage at -20°C or -80°C .

How can comparative studies between Odontella sinensis Photosystem Q(B) protein and other photosystem proteins enhance our understanding of evolutionary adaptations?

Comparative studies between Odontella sinensis Photosystem Q(B) protein and homologs from other organisms provide valuable insights into evolutionary adaptations of photosynthetic systems. The presence of both D1 (psbA) and D2 (psbD) proteins in Odontella sinensis, with distinct sequences and functions, reflects the conserved nature of the PSII reaction center across photosynthetic organisms .

Research Approach:

  • Phylogenetic analysis comparing Photosystem Q(B) protein sequences across diverse photosynthetic organisms

  • Structural modeling based on high-resolution structures from model organisms

  • Functional characterization across environmental gradients (temperature, light intensity, salinity)

  • Examination of species-specific adaptations in quinone binding and electron transfer

Key Research Questions:

  • How have diatom photosystem proteins adapted to marine environments?

  • What structural features are conserved across evolutionary distance?

  • How do sequence variations correlate with environmental adaptations?

Studies of the psbX gene in Synechococcus elongatus revealed that while not essential for photoautotrophic growth, this auxiliary PSII protein affects growth under low CO2 conditions and influences quinone interactions . Similar comparative studies with Odontella sinensis Photosystem proteins could reveal adaptations specific to marine environments or diatom physiology.

Table 1: Comparison of Key Properties Between D1 and D2 Proteins in Odontella sinensis

PropertyPhotosystem Q(B) Protein (D1)Photosystem II D2 Protein
UniProt AccessionP49460P49478
GenepsbApsbD
Length344 amino acids351 amino acids
FunctionBinds QB, secondary electron acceptorBinds QA, primary electron acceptor
EC Number1.10.3.91.10.3.9

What are the most effective experimental designs for studying the effects of environmental factors on Photosystem Q(B) protein function?

Understanding how environmental factors influence Photosystem Q(B) protein function requires carefully designed experiments that can distinguish direct effects on the protein from broader physiological responses. Based on research with related photosystem components, effective experimental approaches include:

Light Intensity and Quality Studies:

  • Measure oxygen evolution rates under varying light intensities and spectral compositions

  • Monitor D1 protein turnover rates using pulse-chase experiments with labeled amino acids

  • Analyze quinone binding and electron transfer kinetics under different light regimes

Temperature Response Experiments:

  • Compare thermal stability of isolated Odontella sinensis Photosystem Q(B) protein with homologs from organisms adapted to different thermal environments

  • Measure activation energies for electron transfer reactions at the QB site across temperature ranges

  • Assess temperature effects on protein-protein interactions within the PSII complex

Oxidative Stress Responses:

  • Expose the protein to controlled oxidative conditions and measure functional changes

  • Identify oxidation-sensitive residues using mass spectrometry

  • Compare the susceptibility to photoinhibition with that of homologs from other species

Research with the psbX gene in Synechococcus elongatus demonstrated that environmental factors like CO2 availability can significantly impact photosystem function, with mutants showing growth defects under low CO2 conditions . This suggests that Photosystem Q(B) protein function may similarly be modulated by environmental parameters, making these experimental approaches particularly valuable for understanding ecological adaptations of photosynthetic organisms.

What are the current research frontiers involving Recombinant Odontella sinensis Photosystem Q(B) protein?

Research frontiers involving the Recombinant Odontella sinensis Photosystem Q(B) protein span fundamental photosynthesis research, comparative biology, and potential biotechnological applications. Current areas of active investigation include:

Structural Biology:
Advanced structural characterization using cryo-electron microscopy and X-ray crystallography continues to reveal the detailed molecular architecture of photosystem complexes. The relationship between structure and function, particularly how specific amino acid residues contribute to quinone binding and electron transfer, remains an active area of research .

Systems Biology Approaches:
Integration of photosystem function into broader metabolic networks provides a systems-level understanding of photosynthesis. The interactions between Photosystem Q(B) protein and other cellular components under varying environmental conditions represent an emerging research frontier.

Evolutionary Biology:
Comparative studies of photosystem proteins across diverse photosynthetic organisms help elucidate the evolutionary history and adaptive significance of structural variations. Research on PSII subunits has revealed both highly conserved functional domains and species-specific adaptations .

Synthetic Biology Applications:
Engineering of photosystem components for enhanced photosynthetic efficiency or novel functions represents a promising frontier. Studies of protein-quinone interactions inform efforts to optimize electron transfer in both natural and artificial photosynthetic systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.