Recombinant Oedogonium cardiacum ATP synthase subunit b, chloroplastic (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
atpF; ATP synthase subunit b, chloroplastic; ATP synthase F(0 sector subunit b; ATPase subunit I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Oedogonium cardiacum (Filamentous green alga)
Target Names
atpF
Target Protein Sequence
MNLLTIFNILPLGEGFGFNDNILETNIINLAAVVGIVVFFVGKNFSILLENRQQTILNNL REANQRASEALERYNQAKKQLELAEKKAKDIRQEGTLKARQEKENCFNQYKLDLVRLEEY KQETLQFYQQKAFQQIYVSIVSRALGEVKQKFNKPLSEQFHATINNFVIARLTEYNP
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core; and the F0 domain, containing the membrane proton channel. These domains are connected by a central and a peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits.

This protein is a component of the F0 channel and forms part of the peripheral stalk, linking F1 and F0.

Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is the biological role of ATP synthase subunit b (atpF) in Oedogonium cardiacum?

ATP synthase subunit b, encoded by the atpF gene in Oedogonium cardiacum chloroplasts, is a critical component of the F(1)F(0) ATP synthase complex. This protein plays an essential structural role as part of the peripheral stalk that connects the F1 catalytic domain to the F0 membrane domain. The peripheral stalk functions as a stationary element during ATP synthesis, providing a crucial counterforce against the rotational torque generated by proton translocation through the F0 domain. This stabilization is essential for the rotary catalysis mechanism that enables ATP production from ADP in the presence of a proton gradient across the thylakoid membrane .

Specifically, atpF participates in maintaining the structural integrity of the ATP synthase complex while allowing the central stalk subunits to rotate within the F1 region during catalysis. This rotation is coupled to proton translocation, ultimately driving the synthesis of ATP, which is vital for all energy-requiring processes in the chloroplast .

How does the structure of atpF in Oedogonium cardiacum compare to homologous proteins in other photosynthetic organisms?

What are the key structural domains of the atpF protein and their specific functions?

The atpF protein contains several key structural domains that are critical for its function in the ATP synthase complex:

  • Membrane-spanning domain: Located at the N-terminal region, this hydrophobic domain anchors the protein within the thylakoid membrane and contributes to the formation of the proton channel in the F0 sector .

  • Connecting domain: This region links the membrane domain to the peripheral stalk and undergoes conformational changes during ATP synthesis .

  • Stalk domain: This elongated structure extends from the membrane into the stromal space and forms part of the peripheral stalk, acting as a stationary stator against which the rotating components can generate torque .

Each domain plays a specific role in ensuring the structural integrity of the ATP synthase complex while allowing for the dynamic movements required during catalysis. Mutations or alterations in these domains can significantly impact the assembly and function of the entire ATP synthase complex, as demonstrated in studies with ATP synthase mutants .

What expression systems are most effective for producing recombinant Oedogonium cardiacum atpF protein?

For successful expression of recombinant Oedogonium cardiacum atpF protein, several expression systems have been evaluated, with varying degrees of efficacy:

  • E. coli expression systems: While bacterial systems offer high yield and relatively simple protocols, they often struggle with proper folding of chloroplastic proteins. When using E. coli, codon optimization is essential, and expression should be attempted with specialized strains designed for membrane proteins (e.g., C41(DE3) or C43(DE3)). Additionally, fusion tags such as MBP (maltose-binding protein) can improve solubility .

  • Chlamydomonas reinhardtii expression: This green algal system provides a more native-like environment for chloroplastic proteins. Recent studies indicate that homologous recombination-based expression in Chlamydomonas can produce functional ATP synthase components with proper post-translational modifications .

  • In vitro translation systems: Cell-free systems utilizing chloroplast extracts have shown promise for expressing difficult membrane proteins like atpF, allowing better control over the translation environment and reducing toxicity issues .

The choice of expression system should be guided by the intended application. For structural studies requiring large amounts of protein, bacterial systems with optimization may be sufficient, while functional studies might benefit from the more authentic processing provided by algal expression systems .

What purification challenges are specific to recombinant atpF, and how can they be overcome?

Purification of recombinant atpF presents several specific challenges that must be addressed for successful isolation:

  • Membrane protein solubilization: As atpF contains hydrophobic domains, effective solubilization requires careful selection of detergents. Studies indicate that mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin are often effective while preserving structural integrity .

  • Maintaining protein-protein interactions: When studying atpF in the context of its interactions within the ATP synthase complex, harsher purification conditions can disrupt these associations. Utilizing gentle crosslinking prior to purification can help preserve these interactions for structural studies .

  • Preventing aggregation: AtpF has a tendency to aggregate during concentration steps. This can be mitigated by:

    • Maintaining detergent concentrations above the critical micelle concentration

    • Including glycerol (10-15%) in buffers

    • Working at reduced temperatures (4°C)

    • Using gradient elution techniques rather than step elutions

  • Affinity tag interference: When tags are used for purification, they may interfere with functional studies. Implementing cleavable tags (TEV protease sites) and confirming protein functionality after tag removal is recommended .

A successful purification protocol typically involves initial isolation using affinity chromatography (His-tag or Strep-tag), followed by size exclusion chromatography to remove aggregates and obtain homogeneous protein preparations .

What are the most reliable assays for determining the functional activity of recombinant atpF protein?

Assessing the functional activity of recombinant atpF requires both direct and indirect approaches, as the protein itself is part of a larger complex:

  • ATP synthase reconstitution assays: The gold standard involves reconstituting purified atpF with other ATP synthase components and measuring ATP synthesis activity in proteoliposomes using luciferase-based ATP detection methods. This approach directly measures functionality but requires all components to be available .

  • Binding assays to partner subunits: Surface plasmon resonance (SPR) or microscale thermophoresis (MST) can be used to quantify binding of atpF to other stalk components (particularly AtpG, the other peripheral stalk protein). Strong and specific binding indicates proper folding and functional capacity .

  • Complementation studies: In systems where atpF knockouts exist (such as Chlamydomonas reinhardtii), transformation with recombinant atpF followed by phenotypic rescue assessment provides strong evidence of functionality. Success is typically measured by restoration of photosynthetic efficiency and ATP synthesis capacity .

  • Structural integrity assessment: Circular dichroism (CD) spectroscopy can verify proper secondary structure formation, while limited proteolysis patterns can confirm correct folding by comparing to patterns from native protein .

Each assay provides different aspects of functional information, and a comprehensive assessment typically requires multiple approaches to confirm both structural integrity and functional capacity of the recombinant atpF protein .

How do mutations in the atpF gene affect chloroplast ATP synthase assembly and function?

Research on ATP synthase mutations, primarily in model organisms like Chlamydomonas reinhardtii, has provided valuable insights that can be applied to understanding Oedogonium cardiacum atpF:

  • Knockout and frameshift mutations: Complete knockout or frameshift mutations in atpF result in the complete absence of functional ATP synthase accumulation. This indicates that atpF is absolutely essential for proper assembly of the complex. In Chlamydomonas, an atpF frameshift mutation prevented ATP synthase function and accumulation entirely .

  • Domain-specific mutations:

    • Mutations in the membrane-spanning domain can disrupt proton channeling efficiency

    • Alterations in the connecting region can impair the transmission of conformational changes

    • Mutations in the stalk domain often affect interactions with other peripheral stalk subunits

  • Assembly intermediate accumulation: When atpF is mutated, specific assembly intermediates accumulate, suggesting a sequential assembly pathway for the ATP synthase complex. Proteomics analysis of these intermediates provides a map of the assembly process and identifies specific roles for atpF at different assembly stages .

  • Stability effects: Some mutations in atpF lead to increased turnover of the entire ATP synthase complex through proteolytic degradation. Crossing ATP synthase mutants with protease mutants (particularly ftsh1-1) has shown that the FTSH protease significantly contributes to the degradation of unassembled ATP synthase components, with AtpH (subunit c) being identified as a direct FTSH substrate .

These findings collectively demonstrate that atpF is not merely a structural component but plays a critical role in the coordinated assembly, stability, and function of the entire chloroplast ATP synthase complex .

What is the relationship between atpF and other subunits in the ATP synthase peripheral stalk?

The peripheral stalk of chloroplast ATP synthase involves a critical relationship between atpF (subunit b) and other components, particularly ATPG (subunit b'):

  • Coordinated accumulation: Studies in Chlamydomonas reinhardtii show that atpF and ATPG accumulation is highly coordinated. Knock-out mutations in either gene prevent ATP synthase function and accumulation, indicating their interdependent relationship .

  • Structural interaction: These two peripheral stalk subunits form a heterodimeric structure that spans from the membrane to the F1 catalytic domain. This heterodimer provides the critical stator function that prevents rotation of the α/β subunits during catalysis .

  • Assembly pathway position: The assembly of the atpF-ATPG heterodimer appears to be an early event in ATP synthase biogenesis, creating a scaffold for subsequent assembly steps. This is evidenced by the complete failure of ATP synthase assembly in mutants lacking either protein .

  • Differential expression control: Despite their coordinated function, atpF and ATPG are under different genetic control - atpF is chloroplast-encoded while ATPG is nuclear-encoded. This necessitates coordinated regulation across cellular compartments. In Chlamydomonas, a knock-down ATPG mutant (with a transposon insertion in the 3'UTR) showed limited accumulation of functional ATP synthase, while complete knockout prevented assembly .

The intricate relationship between these peripheral stalk components highlights the evolutionary adaptation that has occurred since primary endosymbiosis, with regulatory mechanisms evolving to ensure stoichiometric accumulation of components derived from different genetic compartments .

How does the evolutionary history of atpF in Oedogonium cardiacum compare to other green algae?

The evolutionary history of atpF in Oedogonium cardiacum reveals important insights about chloroplast genome evolution in green algae:

  • Phylogenetic positioning: Oedogonium cardiacum belongs to the Oedogoniales order, which molecular evidence places in close alliance with the Chaetophorales. This relationship is supported by shared chloroplast genome features, including gene content patterns and specific gene losses/retentions. The atpF gene is maintained in both lineages, reflecting its essential function .

  • Genomic context conservation: The chloroplast genome of Oedogonium features an atypical quadripartite structure and is notably compact among photosynthetic chlorophytes. Despite this compact nature, atpF has been retained, indicating strong selective pressure for its conservation .

  • Intron patterns: The Oedogonium chloroplast genome is intron-rich (17 group I and 4 group II introns). The presence or absence of introns in atpF can vary between green algal lineages and may provide insights into the evolutionary history of this gene .

  • Gene cluster patterns: Comparative analyses reveal that Oedogonium and Stigeoclonium (Chaetophorales) share derived gene clusters that are absent in members of the CS clade (Chlamydomonadales and Sphaeropleales). These patterns suggest that the atpF genomic context may have undergone rearrangements during the divergence of major green algal lineages .

The evolutionary trajectory of atpF in Oedogonium cardiacum provides evidence for the ancient origin of the ATP synthase complex and demonstrates how different lineages have maintained this essential component while undergoing substantial genomic restructuring .

What are the known regulatory mechanisms controlling atpF expression in chloroplasts?

The expression of atpF in chloroplasts is subject to multiple levels of regulation that ensure proper coordination with other ATP synthase components:

  • Transcriptional regulation: In chloroplasts, the atpF gene is typically part of a polycistronic transcript that includes multiple ATP synthase genes. The transcription is primarily driven by the plastid-encoded RNA polymerase (PEP) with assistance from nuclear-encoded sigma factors that respond to developmental and environmental cues .

  • Post-transcriptional regulation: mRNA processing, including splicing (in species where atpF contains introns), is regulated by nuclear-encoded factors. Research in Chlamydomonas reinhardtii has identified that certain octotricopeptide repeat (OPR) proteins are critical for stabilizing ATP synthase component transcripts .

  • Translational regulation: The initiation of translation on atpF mRNA is regulated by interactions between the 5'UTR and specific nuclear-encoded translational activators. These interactions can be modulated in response to cellular energy status and redox conditions .

  • Post-translational regulation: After synthesis, atpF protein undergoes proper membrane insertion and assembly into the ATP synthase complex. This process is facilitated by chaperones and assembly factors. The assembly process appears to be regulated by the availability of other ATP synthase components, ensuring stoichiometric accumulation .

  • Proteolytic regulation: Unassembled or improperly assembled atpF is subject to degradation by the FTSH protease complex in the thylakoid membrane. This quality control mechanism ensures that only functional protein accumulates .

These multiple regulatory layers reflect the critical importance of maintaining proper ATP synthase function and the need to coordinate the expression of components encoded in different cellular compartments .

How is the biogenesis of atpF coordinated with other ATP synthase components?

The biogenesis of atpF occurs as part of a highly coordinated process that ensures proper assembly of the entire ATP synthase complex:

  • Co-translational membrane insertion: The atpF protein, with its transmembrane domains, requires proper insertion into the thylakoid membrane during or immediately after translation. This process involves the chloroplast SRP (Signal Recognition Particle) pathway and potentially the Alb3/YidC insertase system .

  • Assembly partnerships: Research in Chlamydomonas reinhardtii has revealed that atpF forms an early assembly intermediate with ATPG (subunit b'), its partner in the peripheral stalk. This interaction appears to be a critical checkpoint in the assembly process, as evidenced by the complete prevention of ATP synthase accumulation in either atpF or ATPG knockout mutants .

  • Concerted accumulation mechanism: There appears to be a regulatory mechanism ensuring the stoichiometric accumulation of ATP synthase components. This is particularly evident in studies showing that when one component is absent, others may be rapidly degraded by the FTSH protease. This suggests a "completion check" during assembly that prevents accumulation of partial complexes .

  • Nuclear-chloroplast coordination: The ATP synthase complex requires components from both the chloroplast (including atpF) and nuclear genomes. The coordination between these genetic compartments involves anterograde (nucleus to chloroplast) and retrograde (chloroplast to nucleus) signaling pathways. These signals adjust the expression of components from both compartments to maintain proper stoichiometry .

  • Integration with metabolic status: Recent research suggests that ATP synthase assembly may be integrated with cellular metabolic status through NADH-sensing mechanisms. This could allow cells to adjust ATP synthase capacity in response to changing energy demands, though the specific impact on atpF has not been directly demonstrated .

This multi-layered coordination ensures that atpF is produced and assembled in concert with other ATP synthase components, preventing waste of cellular resources and ensuring optimal energy production capacity .

What role do nuclear-encoded factors play in atpF mRNA stability and translation?

Nuclear-encoded factors play crucial roles in regulating atpF mRNA stability and translation, demonstrating the complex interplay between the nuclear and chloroplast genomes:

  • OPR proteins and mRNA stability: Studies in Chlamydomonas reinhardtii have identified that octotricopeptide repeat (OPR) proteins are critical for stabilizing chloroplast transcripts. For example, the nuclear-encoded factor MDE1, an OPR protein, specifically targets the 5'UTR of the atpE transcript. While this specific example involves atpE rather than atpF, it demonstrates the principle that nuclear-encoded RNA-binding proteins provide transcript-specific regulation in chloroplasts .

  • Translational activators: Nuclear-encoded proteins bind to the 5'UTR of chloroplast mRNAs to promote translation initiation. These factors often respond to various cellular signals, allowing translation rates to be adjusted according to developmental stage, light conditions, and metabolic status .

  • RNA processing enzymes: The splicing of introns (when present in atpF) requires nuclear-encoded splicing factors. Additionally, endonucleases and exonucleases involved in transcript processing and turnover are predominantly nuclear-encoded .

  • Evolutionary implications: The recruitment of nuclear factors for chloroplast gene expression represents an evolutionary solution to the challenge of coordinating gene expression between two genetic compartments. This study of Chlamydomonas indicates that some of these regulatory relationships are relatively recent evolutionary innovations. For example, the MDE1-atpE relationship appears to have evolved in the ancestor of the CS clade of Chlorophyceae approximately 300 million years ago .

This complex regulatory network highlights how the chloroplast genome, despite retaining genes like atpF, has become increasingly dependent on nuclear-encoded factors for proper gene expression and protein accumulation .

How does the function of Oedogonium cardiacum atpF compare to ATP synthase components in other organisms?

Comparative analysis reveals both conserved and unique aspects of Oedogonium cardiacum atpF relative to other organisms:

This comparative perspective demonstrates how a fundamental component of cellular energy metabolism has been maintained through evolution while allowing for species-specific adaptations in structure and regulation .

What experimental systems are most suitable for studying atpF function in vivo?

Several experimental systems offer advantages for studying atpF function in vivo, each with specific strengths:

  • Chlamydomonas reinhardtii: This green alga has emerged as the premier model system for studying chloroplast ATP synthase components:

    • Well-established transformation methods for both nuclear and chloroplast genomes

    • Extensive mutant collections, including ATP synthase mutants

    • Ability to grow heterotrophically, allowing the isolation of photosynthetic mutants

    • Demonstrated utility in studies of peripheral stalk components, including atpF and ATPG

  • Synechocystis sp. PCC 6803: This cyanobacterium provides a simpler prokaryotic system:

    • Natural transformation capability

    • Single cellular compartment simplifies genetic manipulation

    • Closer to the ancestral state of the chloroplast, providing evolutionary insights

    • Well-characterized ATP synthase with homologous components to chloroplast enzymes

  • In vitro reconstitution systems:

    • Allow precise control over component stoichiometry

    • Enable the study of specific interactions without cellular complexity

    • Can incorporate modified or labeled proteins for detailed functional studies

    • Particularly useful for studying the assembly process and subcomplexes

  • Oedogonium cardiacum itself:

    • While less developed as a model system, studying atpF in its native context provides the most direct insights

    • Comparative studies with other algal systems can highlight unique adaptations

    • Emerging genetic tools may make this system more accessible in the future

The choice of experimental system should be guided by the specific research questions being addressed. For detailed molecular mechanisms, Chlamydomonas or in vitro systems may be most appropriate, while evolutionary questions might benefit from comparative studies across multiple algal species including Oedogonium .

How can structural studies of atpF contribute to understanding ATP synthase assembly and function?

Structural studies of atpF can provide critical insights into multiple aspects of ATP synthase biology:

  • Assembly pathway elucidation: Determining the structure of atpF in isolation, in subcomplexes, and within the complete ATP synthase can reveal:

    • Conformational changes that occur during assembly

    • Critical interaction interfaces with other subunits

    • Potential assembly checkpoints and regulation points

    These insights can map the sequential steps in ATP synthase biogenesis and identify potential intervention points for modulating activity .

  • Mechanism of action understanding: High-resolution structures of the peripheral stalk including atpF can reveal:

    • How the stator withstands the mechanical forces generated during catalysis

    • The specific contacts that prevent rotation of the α/β subunits

    • Potential flexibility or rigidity in different regions that contribute to function

    This mechanical understanding is crucial for comprehending the nanomotor properties of ATP synthase .

  • Evolutionary insights: Comparative structural analysis of atpF across species can:

    • Identify conserved structural elements that are essential for function

    • Reveal species-specific adaptations that may reflect different environmental pressures

    • Provide evidence for convergent or divergent evolution in different lineages

    These comparisons can illuminate how this ancient molecular machine has been preserved and adapted throughout evolutionary history .

  • Therapeutic target development: While primarily applicable to mitochondrial ATP synthase, structural insights from chloroplast homologs can:

    • Reveal potential binding sites for inhibitors or activators

    • Guide the design of compounds that modulate ATP synthase activity

    • Inform understanding of how mutations lead to dysfunction

    These applications extend beyond plants and algae to human health, where ATP synthase is implicated in various diseases .

Current structural techniques particularly relevant for atpF studies include cryo-electron microscopy, which has revolutionized our ability to visualize large membrane protein complexes, and integrative structural biology approaches that combine multiple experimental techniques (X-ray crystallography, NMR, crosslinking mass spectrometry) to build comprehensive structural models .

What are common challenges in working with recombinant atpF and how can they be overcome?

Researchers working with recombinant atpF frequently encounter several challenges:

  • Protein aggregation and insolubility:

    • Challenge: The hydrophobic transmembrane regions of atpF often cause aggregation during expression and purification.

    • Solutions:

      • Use mild detergents like DDM or digitonin for solubilization

      • Express as fusion proteins with solubility-enhancing tags (MBP, SUMO)

      • Employ amphipols or nanodiscs for membrane protein stabilization

      • Consider coexpression with interaction partners to promote proper folding

  • Low expression levels:

    • Challenge: Membrane proteins often express poorly in heterologous systems.

    • Solutions:

      • Optimize codon usage for the expression host

      • Reduce expression temperature (often 16-20°C)

      • Try specialized expression strains (C41, C43 for E. coli)

      • Consider homologous expression systems (e.g., Chlamydomonas)

  • Functional assessment difficulties:

    • Challenge: As part of a multisubunit complex, isolated atpF cannot perform its native function alone.

    • Solutions:

      • Develop binding assays to verify interactions with partner subunits

      • Establish reconstitution systems with other purified components

      • Utilize complementation assays in model organisms

      • Assess structural integrity through biophysical methods as a proxy for function

  • Verification of native conformation:

    • Challenge: Ensuring the recombinant protein adopts its natural structure.

    • Solutions:

      • Compare circular dichroism (CD) spectra with native protein

      • Use limited proteolysis patterns as conformational fingerprints

      • Verify binding to known interaction partners

      • Employ conformation-specific antibodies when available

  • Stability during storage:

    • Challenge: Membrane proteins often lose activity during storage.

    • Solutions:

      • Add glycerol (10-15%) to storage buffers

      • Store at higher concentrations to minimize surface denaturation

      • Consider flash-freezing in liquid nitrogen rather than slow freezing

      • Test stability of different constructs and storage conditions empirically

By addressing these common challenges systematically, researchers can improve the likelihood of successful experiments with recombinant atpF protein .

How can researchers effectively distinguish between assembly defects and functional defects when studying atpF mutations?

Distinguishing between assembly defects and functional defects in atpF mutations requires a systematic analytical approach:

  • Quantitative assessment of ATP synthase complex levels:

    • Methodology: Blue native PAGE followed by immunoblotting with antibodies against various ATP synthase subunits can quantify fully assembled complex versus subcomplexes or free subunits.

    • Interpretation: Significantly reduced levels of fully assembled complex with accumulation of subcomplexes suggest assembly defects, while normal assembly with reduced activity indicates functional defects .

  • Examination of assembly intermediates:

    • Methodology: Sucrose gradient centrifugation combined with mass spectrometry can identify and characterize assembly intermediates.

    • Interpretation: Specific intermediates accumulating in mutants can pinpoint precisely where in the assembly pathway the defect occurs. The presence of atpF in these intermediates versus its absence provides insight into when the mutation impacts assembly .

  • Protein stability analysis:

    • Methodology: Pulse-chase experiments with radiolabeled amino acids can determine if the mutant protein is synthesized normally but degraded rapidly.

    • Interpretation: Normal synthesis with rapid degradation suggests proper initial production but failure to assemble correctly, triggering quality control degradation .

  • In vitro reconstitution tests:

    • Methodology: Purified components including wildtype or mutant atpF can be combined in controlled reconstitution experiments.

    • Interpretation: If mutant atpF can physically incorporate into subcomplexes but the resulting complex lacks activity, this suggests a functional rather than assembly defect .

  • Structure-function correlation:

    • Methodology: Mapping mutations onto structural models and correlating with biochemical data.

    • Interpretation: Mutations in interaction interfaces likely cause assembly defects, while those in catalytically important regions that don't disrupt protein-protein interactions may cause functional defects .

  • Protease protection assays:

    • Methodology: Limited proteolysis of isolated complexes containing wildtype or mutant atpF.

    • Interpretation: Different digestion patterns suggest conformational changes that may impact function without preventing assembly .

Research in Chlamydomonas reinhardtii has demonstrated the utility of these approaches, particularly in distinguishing between knockdown effects (as seen with transposon insertion in ATPG 3'UTR) versus complete knockout effects (frameshift mutations), which can provide valuable insights applicable to atpF studies .

What are the best approaches for studying atpF interactions with other ATP synthase components?

Several complementary approaches can effectively characterize the interactions between atpF and other ATP synthase components:

  • Crosslinking coupled with mass spectrometry (XL-MS):

    • Methodology: Chemical crosslinkers of defined length create covalent bonds between spatially proximal amino acids. After digestion, crosslinked peptides are identified by mass spectrometry.

    • Advantages: Provides specific residue-level interaction data in native or near-native conditions

    • Considerations: Requires careful optimization of crosslinking conditions and sophisticated data analysis

  • Co-immunoprecipitation (Co-IP) studies:

    • Methodology: Antibodies against atpF or epitope-tagged versions can pull down intact complexes for analysis of interacting partners.

    • Advantages: Works in native conditions and can detect both strong and weak interactions

    • Considerations: May identify indirect interactions within larger complexes

  • Split reporter assays:

    • Methodology: Fusion of potential interacting partners to complementary fragments of a reporter protein (e.g., split GFP, split luciferase).

    • Advantages: Can be performed in vivo and provides spatial information about where interactions occur

    • Considerations: May introduce artifacts due to fusion proteins

  • Surface plasmon resonance (SPR) or microscale thermophoresis (MST):

    • Methodology: Quantitative measurement of binding interactions using purified components.

    • Advantages: Provides kinetic and thermodynamic parameters of interactions

    • Considerations: Requires purified proteins and may not fully reflect membrane environment

  • Genetic suppressor screens:

    • Methodology: Identification of second-site mutations that rescue atpF mutant phenotypes.

    • Advantages: Can reveal unexpected functional relationships and compensatory mechanisms

    • Considerations: Labor-intensive and requires a genetic system like Chlamydomonas

  • Structural analysis of subcomplexes:

    • Methodology: Cryo-EM or X-ray crystallography of isolated subcomplexes containing atpF.

    • Advantages: Provides detailed 3D information about interaction interfaces

    • Considerations: Technically challenging and may not capture dynamic aspects of interactions

Research in Chlamydomonas reinhardtii has demonstrated that combining these approaches provides complementary insights. For example, studies have shown that atpF forms a heterodimeric structure with ATPG, and both components are essential for ATP synthase assembly and function. The absence of either component prevents the accumulation of functional ATP synthase, indicating their interdependent relationship .

What are the key unresolved questions about atpF that require further investigation?

Despite significant advances in understanding ATP synthase, several critical questions about atpF remain unresolved:

  • Assembly pathway dynamics: The precise sequence and timing of events during atpF incorporation into the ATP synthase complex remains unclear. Questions include:

    • Which specific chaperones assist atpF membrane insertion?

    • What are the earliest interaction partners during assembly?

    • How is atpF properly oriented in the membrane?

  • Regulatory mechanisms: The regulation of atpF expression and incorporation requires further investigation:

    • What specific factors bind the atpF mRNA to regulate its translation?

    • How is atpF expression coordinated with nuclear-encoded partners?

    • What post-translational modifications occur and how do they affect function?

  • Species-specific adaptations: Comparative studies are needed to understand:

    • How does the structure and function of atpF vary across algal lineages?

    • Do these variations reflect adaptations to different photosynthetic environments?

    • What evolutionary pressures have shaped atpF in Oedogonium specifically?

  • Structural dynamics: While static structures provide valuable insights, questions about dynamics remain:

    • How does atpF respond to the mechanical stresses during ATP synthesis?

    • Are there conformational changes in response to different physiological conditions?

    • How does the flexibility or rigidity of different atpF domains contribute to function?

  • Interaction network complexity: Beyond the core ATP synthase complex:

    • Does atpF interact with other thylakoid membrane complexes?

    • Are there regulatory proteins that temporarily associate with atpF?

    • How does atpF contribute to supercomplex formation or membrane organization?

Addressing these questions will require integrating advanced structural methods, in vivo imaging techniques, and genetic approaches, particularly in model systems like Chlamydomonas while extending findings to diverse species including Oedogonium cardiacum .

How might advances in structural biology techniques enhance our understanding of atpF?

Emerging structural biology techniques offer exciting opportunities to deepen our understanding of atpF structure, function, and interactions:

  • Cryo-electron tomography (cryo-ET):

    • Potential applications: Visualizing ATP synthase with atpF in its native membrane environment rather than in detergent-solubilized preparations.

    • Expected insights: Revealing the natural organization, clustering, and potential interactions with other membrane complexes in intact thylakoids .

  • Time-resolved cryo-EM:

    • Potential applications: Capturing different conformational states of atpF during the ATP synthesis cycle.

    • Expected insights: Visualizing dynamic structural changes and intermediate states that are critical for function but transient in nature .

  • Integrative structural biology:

    • Potential applications: Combining multiple experimental techniques (X-ray crystallography, NMR, SAXS, crosslinking-MS) with computational modeling.

    • Expected insights: Building comprehensive structural models that incorporate both static architecture and dynamic behavior of atpF within the ATP synthase complex .

  • Single-molecule fluorescence resonance energy transfer (smFRET):

    • Potential applications: Monitoring distance changes between labeled positions in atpF and other subunits during function.

    • Expected insights: Direct observation of conformational dynamics during the catalytic cycle, providing mechanistic details of how mechanical force is transmitted and resisted .

  • In-cell structural biology:

    • Potential applications: Techniques like in-cell NMR or correlative light and electron microscopy (CLEM).

    • Expected insights: Observing atpF structure and dynamics in living cells, capturing native interactions and conformations .

These advanced approaches, particularly when applied in complementary fashion, promise to bridge the gap between static structural snapshots and dynamic functional mechanisms, providing a more complete understanding of how atpF contributes to ATP synthase function in Oedogonium cardiacum and other photosynthetic organisms .

What potential biotechnological applications might emerge from research on ATP synthase subunit b?

Research on ATP synthase subunit b (atpF) could lead to several innovative biotechnological applications:

  • Enhanced photosynthetic efficiency:

    • Approach: Engineering optimized versions of atpF with altered interactions or regulatory properties.

    • Potential impact: Improving ATP production efficiency in algae or plants could enhance biomass production for biofuels or agricultural yields by optimizing energy conversion .

  • Biosensors for environmental monitoring:

    • Approach: Developing sensors based on atpF conformational changes in response to inhibitors or environmental conditions.

    • Potential impact: Creating sensitive detection systems for herbicides, heavy metals, or other pollutants that affect ATP synthase function .

  • Bioinspired nanomotors:

    • Approach: Using the structural principles of the ATP synthase stator system (including atpF) to design artificial molecular motors.

    • Potential impact: Creating efficient nanoscale devices for various applications in nanotechnology and medicine .

  • Photosynthetic bioreactors:

    • Approach: Engineering algal strains with modified ATP synthase properties for specific applications.

    • Potential impact: Optimizing microalgae for CO2 capture, biofuel production, or synthesis of high-value compounds by enhancing energy conversion efficiency .

  • Therapeutic target insights:

    • Approach: Using structural and functional information from algal atpF to inform studies on the homologous components in human mitochondrial ATP synthase.

    • Potential impact: Developing treatments for mitochondrial diseases or identifying new antibacterial targets based on structural differences between bacterial and eukaryotic ATP synthases .

  • Stress-tolerant crop development:

    • Approach: Transferring insights from algal ATP synthase adaptation to engineer more resilient plant energy systems.

    • Potential impact: Creating crops with improved tolerance to environmental stresses like drought or high temperatures by optimizing energy metabolism under adverse conditions .

While these applications remain largely theoretical at present, the fundamental research on atpF structure, function, and regulation provides the essential knowledge foundation for such biotechnological innovations .

What are the most significant recent advances in understanding atpF and chloroplast ATP synthase function?

Recent research has yielded several significant advances in our understanding of atpF and chloroplast ATP synthase:

  • Peripheral stalk essentiality: Studies in Chlamydomonas reinhardtii have definitively demonstrated that both peripheral stalk components (atpF and ATPG) are absolutely essential for ATP synthase assembly and function. Knockout mutations in either gene completely prevent ATP synthase accumulation, highlighting their critical structural role .

  • Assembly pathway insights: Research has begun to elucidate the sequential assembly of ATP synthase components, with the peripheral stalk formation appearing to be an early critical step. The identification of assembly intermediates has provided a clearer picture of the biogenesis process .

  • Quality control mechanisms: The discovery that the FTSH protease significantly contributes to the degradation of unassembled ATP synthase components has revealed important quality control mechanisms. This finding demonstrates how cells prevent the accumulation of non-functional subcomplexes .

  • Nuclear-chloroplast coordination: The identification of nuclear-encoded factors that regulate chloroplast gene expression, such as the OPR protein MDE1 that stabilizes atpE mRNA, has illuminated the intricate coordination between the nuclear and chloroplast genomes in ensuring proper ATP synthase biogenesis .

  • Evolutionary insights: Comparative genomic analyses, including studies of Oedogonium cardiacum, have revealed how chloroplast genomes have undergone substantial restructuring while maintaining essential components like atpF. This demonstrates the strong selective pressure for conserving ATP synthase function despite genomic rearrangements .

  • Metabolic integration: Emerging research suggests ATP synthase function may be integrated with cellular metabolic status through mechanisms such as NADH sensing, potentially allowing cells to adjust ATP production capacity in response to changing energy demands .

These advances collectively provide a more comprehensive understanding of how atpF contributes to ATP synthase structure, function, and regulation in chloroplasts, with implications for both basic science and potential biotechnological applications .

How do the findings from atpF research contribute to our broader understanding of chloroplast biology?

Research on atpF provides valuable insights that extend beyond ATP synthase itself to broader aspects of chloroplast biology:

  • Organellar gene expression regulation: The study of atpF has revealed principles of chloroplast gene expression regulation, showing how nuclear-encoded factors control the stability, processing, and translation of chloroplast mRNAs. This exemplifies the complex coordination required between the nuclear and chloroplast genomes .

  • Membrane protein complex assembly: The assembly pathway of ATP synthase, including atpF incorporation, serves as a model system for understanding how large multisubunit complexes are assembled in chloroplast membranes. This knowledge is applicable to other thylakoid membrane complexes .

  • Chloroplast genome evolution: Comparative analyses involving Oedogonium cardiacum and other algae have demonstrated how essential genes like atpF are maintained despite substantial genomic restructuring. This provides insights into the evolutionary forces shaping chloroplast genomes .

  • Organellar quality control systems: Research showing how unassembled ATP synthase components are degraded by proteases like FTSH illustrates the sophisticated quality control mechanisms operating in chloroplasts to prevent accumulation of non-functional proteins .

  • Nuclear-chloroplast communication: The identification of specific nuclear-encoded factors targeting chloroplast transcripts demonstrates the evolved mechanisms for inter-compartmental coordination. For example, the discovery that MDE1, an OPR protein, specifically targets atpE mRNA illustrates how nuclear factors have been recruited to regulate chloroplast gene expression .

  • Energetic coupling in photosynthesis: ATP synthase function is intimately linked to the light reactions of photosynthesis, and research on atpF contributes to understanding how these processes are coordinated to optimize energy conversion efficiency .

  • Adaptation to environmental conditions: Studies across different species reveal how ATP synthase components, including atpF, may be adapted to different photosynthetic environments, providing insights into chloroplast adaptation mechanisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.