Recombinant Oenomys hypoxanthus Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Oenomys hypoxanthus (Rufous-nosed rat)
Target Names
Target Protein Sequence
MAYPFQLGLQDATSPIMEELTNFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETIWTILPAVILILIALPSLRILYMMDEINNPALTVKTMGHQWYWSYEYTDYEDLCFDS YMIPTTDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QATVTSNRPGLFYGQCSEICGSNHSFMPIVLEMVPLKYFENWSASMI
Uniprot No.

Target Background

Function

Recombinant Oenomys hypoxanthus Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain. This enzyme drives oxidative phosphorylation. The respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (CIV). These complexes cooperatively transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient powers transmembrane transport and ATP synthase. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred via the CuA center of subunit 2 and heme A of subunit 1 to the active site in subunit 1 – a binuclear center (BNC) comprising heme A3 and CuB. The BNC reduces molecular oxygen to two water molecules using four electrons from cytochrome c and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of MT-CO2 and how does it function in mammalian systems?

Cytochrome c oxidase subunit 2 (MT-CO2) represents one of three mitochondrial DNA-encoded subunits (alongside MT-CO1 and MT-CO3) of respiratory complex IV. This essential protein contains approximately 227 amino acids forming a 25.6 kDa structure in most mammals . The protein features two primary domains: an N-terminal region containing two transmembrane alpha-helices embedded in the mitochondrial inner membrane, and a critical functional domain housing a binuclear copper A center (CuA) .

The CuA redox center, located within a conserved cysteine loop at positions 196 and 200 with a conserved histidine at position 204, serves as the primary electron acceptor from cytochrome c . MT-CO2 plays a crucial role in the electron transport chain, facilitating electron transfer from cytochrome c to oxygen, ultimately contributing to ATP production through oxidative phosphorylation.

How does Oenomys hypoxanthus MT-CO2 differ from other rodent species?

While the search results don't provide specific sequence data for Oenomys hypoxanthus MT-CO2, we can make informed comparisons based on related rodent species. Based on available data from Arvicanthis somalicus (Neumann's grass rat), another African rodent species, we can expect significant sequence conservation in functional domains while maintaining species-specific variations .

The amino acid sequence likely contains key conserved residues essential for electron transport function, particularly in the copper-binding domain. Comparative analysis between Arvicanthis somalicus and other rodent MT-CO2 sequences reveals conservation patterns typical of functionally critical mitochondrial proteins . For experimental work with Oenomys hypoxanthus MT-CO2, researchers should anticipate similar functional domains while accounting for species-specific variations that may affect antibody binding, enzyme kinetics, or protein-protein interactions.

What expression systems are optimal for recombinant MT-CO2 production?

  • Transmembrane domains - MT-CO2 contains hydrophobic transmembrane regions that may affect proper folding in prokaryotic systems

  • Post-translational modifications - While not extensively documented for MT-CO2, any native modifications would require eukaryotic expression systems

  • Protein solubility - Addition of solubility-enhancing tags or fusion partners may improve yield

  • Functional requirements - If enzymatic activity studies are planned, proper folding is critical

For functional studies, researchers may consider alternative expression systems such as yeast, insect cells, or mammalian cells to achieve more native-like protein conformation.

What purification strategies yield highest purity and activity for recombinant MT-CO2?

A multi-step purification protocol is recommended for recombinant MT-CO2:

  • Immobilized metal affinity chromatography (IMAC): For His-tagged constructs, Ni-NTA or Co-based resins provide initial capture with buffers containing imidazole gradients for elution

  • Size exclusion chromatography: To separate oligomeric states and remove aggregates

  • Ion exchange chromatography: For final polishing and removal of contaminants

Critical buffer considerations include:

  • Inclusion of 6% trehalose as a stabilizing agent during storage

  • pH maintenance at 8.0 for optimal stability

  • Addition of mild detergents (0.05-0.1% DDM or LMNG) to stabilize transmembrane domains

  • Glycerol (20-50%) for long-term storage at -20°C/-80°C

Researchers should validate protein purity using SDS-PAGE (aiming for >90% purity) and confirm identity through Western blotting or mass spectrometry .

How should activity assays be designed for recombinant MT-CO2?

Activity assessment for recombinant MT-CO2 requires consideration of its role within cytochrome c oxidase complex:

  • Electron transfer assays: Measuring electron transfer rates from reduced cytochrome c using spectrophotometric methods

  • Oxygen consumption measurements: Using oxygen-sensitive electrodes or fluorescent probes to assess terminal oxidase activity

  • Binding studies: Evaluating interactions with natural partners using surface plasmon resonance or isothermal titration calorimetry

  • Reconstitution experiments: Incorporating recombinant MT-CO2 into liposomes or nanodiscs with other complex IV subunits to assess assembly

Control experiments should include:

  • Negative controls using denatured protein

  • Comparison with native complex IV activity

  • Tests for inhibitor sensitivity (e.g., cyanide, azide)

  • Assessment of copper incorporation using spectroscopic methods

What considerations are important when designing experiments involving CO2/bicarbonate sensitivity?

Recent research has revealed an important connection between CO2/bicarbonate levels and mitochondrial function through tRNA modifications that affect mitochondrial translation. When designing experiments with MT-CO2, researchers should consider:

  • The extremely high Km value (31 mM) for CO2/bicarbonate in tRNA modification reactions indicates this can be a rate-limiting factor for mitochondrial protein synthesis

  • Cell culture conditions significantly affect bicarbonate levels, with standard incubator conditions (5% CO2) typically maintaining approximately 25 mM bicarbonate

  • Experiments conducted without supplemental bicarbonate may result in reduced mitochondrial translation efficiency, potentially affecting MT-CO2 expression levels

For in vitro studies with recombinant MT-CO2, buffer systems should maintain consistent bicarbonate levels, particularly when comparing results across different experimental conditions or when reconstituting enzymatic activity.

How can recombinant MT-CO2 be used to investigate mitochondrial disease mechanisms?

Recombinant MT-CO2 provides a valuable tool for investigating mitochondrial diseases through several experimental approaches:

  • Structure-function analysis: Introducing disease-associated mutations to recombinant MT-CO2 allows direct assessment of their impact on protein stability, electron transfer efficiency, and complex assembly

  • Interaction studies: Evaluating how MT-CO2 mutations affect binding to other respiratory complex components

  • Translational efficiency: Investigating the role of tRNA modifications in MT-CO2 synthesis, particularly relevant since defects in N6-threonylcarbamoyladenosine (t6A37) formation have been linked to mitochondrial disease

  • Complementation experiments: Using recombinant protein to rescue function in cells with MT-CO2 deficiencies

Research has demonstrated that OSGEPL1-knockout cells exhibit respiratory defects and reduced mitochondrial translation, indicating the crucial role of proper tRNA modification in mitochondrial function . This suggests that defects in MT-CO2 synthesis or function could contribute to mitochondrial disease phenotypes through similar mechanisms.

What approaches are most effective for studying MT-CO2 evolution across rodent species?

Evolutionary analysis of MT-CO2 across rodent species requires integration of multiple approaches:

  • Comparative sequence analysis: Multiple sequence alignment to identify conserved functional domains versus variable regions, which may indicate adaptive evolution

  • Selection pressure analysis: Calculation of dN/dS ratios to detect signatures of positive or purifying selection

  • Structural biology: Homology modeling based on crystal structures to map sequence variations onto three-dimensional structure

  • Functional comparisons: Enzymatic assays comparing recombinant MT-CO2 from different species under standardized conditions

  • Ecological correlation: Analysis of sequence variations in context of species habitat, diet, or metabolic requirements

The identification of orthonairovirus sequences in various rodent species, including those captured in Central Africa, highlights the importance of considering viral interactions when studying mitochondrial genes across species . Viral pressure may contribute to selection on mitochondrial proteins, potentially influencing MT-CO2 evolution.

How can recombinant MT-CO2 contribute to research on viral-host interactions in rodents?

Recent studies have identified novel viruses in rodents from Africa, suggesting important viral-host interactions that may involve mitochondrial function . Recombinant MT-CO2 can contribute to this research through:

  • Interaction screening: Testing whether viral proteins directly interact with MT-CO2 or other mitochondrial components

  • Functional impact assessment: Measuring how viral infection affects cytochrome c oxidase activity

  • Comparative susceptibility: Investigating whether species-specific MT-CO2 variations correlate with viral susceptibility

  • Innate immunity connections: Exploring the relationship between mitochondrial function and antiviral responses

Research has shown that some viruses encode proteins that can suppress interferon signaling , which could indirectly affect mitochondrial function. Since mitochondria play key roles in innate immunity and cellular stress responses, MT-CO2 function may be modulated during viral infection, making recombinant protein studies valuable for understanding these interactions.

What control experiments are necessary to validate recombinant MT-CO2 functional studies?

Rigorous validation of recombinant MT-CO2 functional studies requires multiple control experiments:

Control TypePurposeImplementation
Expression system controlsAccount for expression system artifactsCompare protein expressed in different systems (E. coli vs. eukaryotic)
Tag interference controlsAssess impact of purification tagsCompare tagged vs. untagged protein after tag removal
Protein quality controlsEnsure proper folding and stabilityCircular dichroism, thermal shift assays, dynamic light scattering
Activity baseline controlsEstablish reference activity levelsCompare with native complex IV or commercial preparations
Buffer composition controlsAccount for buffer effectsSystematic variation of pH, salt, and stabilizing agents
Species comparison controlsValidate species-specific findingsTest equivalent constructs from related species

Additionally, researchers should implement experimental replication strategies including:

  • Technical replicates (minimum n=3) to assess measurement precision

  • Biological replicates using independent protein preparations

  • Inter-laboratory validation for critical findings

How should researchers interpret differences between recombinant and native MT-CO2?

When comparing recombinant MT-CO2 with native protein, several factors must be considered:

  • Membrane environment: Native MT-CO2 functions within the mitochondrial inner membrane with specific lipid composition, while recombinant protein typically lacks this environment

  • Complex assembly: MT-CO2 normally functions as part of the larger cytochrome c oxidase complex, so isolated recombinant protein may exhibit different properties

  • Post-translational modifications: Any native modifications may be absent in recombinant protein, particularly when expressed in prokaryotic systems

  • Copper incorporation: Efficient incorporation of copper into the CuA center is essential for function and may vary between recombinant and native protein

Statistical analysis should include appropriate tests for significance depending on data distribution, with p-values <0.05 considered significant . When presenting comparative data, researchers should clearly indicate experimental conditions and protein preparation methods to facilitate proper interpretation.

What challenges exist in extrapolating from in vitro findings to in vivo MT-CO2 function?

Researchers face several challenges when extrapolating from recombinant protein studies to in vivo function:

  • Cellular environment complexity: The mitochondrial environment includes numerous factors (pH gradients, membrane potential, metabolite concentrations) difficult to replicate in vitro

  • Regulatory interactions: MT-CO2 function may be modulated by regulatory proteins, post-translational modifications, or allosteric effectors not present in simplified in vitro systems

  • Tissue-specific variations: MT-CO2 activity and regulation may differ across tissues with varying metabolic demands

  • Developmental changes: Expression and function may vary during development or aging

  • Species differences: Findings from one species may not directly translate to others due to evolutionary adaptations

To address these challenges, researchers should:

  • Validate key findings in cellular models when possible

  • Use complementary approaches (biochemical, structural, genetic)

  • Consider physiological relevance of experimental conditions (temperature, pH, ion concentrations)

  • Implement appropriate statistical analysis methods for complex data sets

How might emerging technologies enhance MT-CO2 research?

Several emerging technologies offer new opportunities for advancing MT-CO2 research:

  • Cryo-electron microscopy: Allowing visualization of MT-CO2 within the complete cytochrome c oxidase complex at near-atomic resolution without crystallization

  • Native mass spectrometry: Enabling analysis of intact membrane protein complexes with preserved interactions

  • Single-molecule techniques: Providing insights into conformational dynamics during electron transfer

  • CRISPR-based approaches: Facilitating precise genetic manipulation to study MT-CO2 variants in cellular contexts

  • Advanced computational methods: Improving prediction of structure-function relationships and evolutionary trajectories

These technologies could help address longstanding questions about species-specific adaptations in MT-CO2 and their functional significance in different ecological contexts.

What are the most promising applications of MT-CO2 research for understanding mitochondrial diseases?

MT-CO2 research holds significant promise for advancing our understanding of mitochondrial diseases through:

  • Precision medicine approaches: Correlating specific MT-CO2 variants with disease phenotypes and treatment responses

  • Biomarker development: Using MT-CO2 structural or functional measures as indicators of mitochondrial health

  • Therapeutic targeting: Developing compounds that can modulate or stabilize MT-CO2 function

  • Gene therapy strategies: Designing approaches to correct MT-CO2 deficiencies

Recent discoveries regarding tRNA modifications and their sensitivity to CO2/bicarbonate levels suggest new therapeutic avenues focused on metabolic interventions that might improve mitochondrial translation efficiency in disease states .

How can comparative studies of MT-CO2 contribute to our understanding of metabolic adaptation?

Comparative studies of MT-CO2 across species provide valuable insights into metabolic adaptation:

  • Altitude adaptation: Investigating MT-CO2 variations in species from different elevations to understand oxygen utilization efficiency

  • Thermal adaptation: Comparing MT-CO2 from species adapted to different temperature ranges to identify structural stability mechanisms

  • Metabolic rate correlation: Analyzing whether MT-CO2 variations correlate with species-specific differences in metabolic rate

  • Diet-related adaptations: Exploring whether dietary specialization drives selection on respiratory chain components

For Oenomys hypoxanthus specifically, comparative studies could reveal adaptations related to its ecological niche in African forests and its specialized diet, potentially identifying unique features that distinguish it from other rodent species captured in similar environments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.