Recombinant Oenothera argillicola Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Oenothera argillicola Apocytochrome f (petA)

Recombinant Oenothera argillicola Apocytochrome f (petA) is a protein expressed from the petA gene in Oenothera argillicola (a species of evening primrose) using recombinant DNA technology . Apocytochrome f is a component of the cytochrome b6f complex, which is essential for photosynthetic electron transfer in plants .

Characteristics

  • Source Organism: Oenothera argillicola (a specific species of evening primrose)

  • Protein Type: Recombinant protein

  • Gene Name: petA

  • Protein Name: Apocytochrome f

  • Expression Region: Amino acids 34-318

  • AA Sequence: YPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDRQVKQVLANGKKGGLNVGAVLILPEGFELAPPARISPEMKERIGNPSFQSYRPTKKNILVIGPVPGQKYSEITFPILSPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGIVSKIIRKEKGGYEITITDASDGRQVVDIIPSGPELLVSEGESIKLDQPLTSNPNVGGFGQGDAEVVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF

  • Storage: It is recommended to store the protein at -20°C, or for extended storage, conserve at -20°C or -80°C . Repeated freezing and thawing is not recommended . It is advised to store working aliquots at 4°C for up to one week .

  • Storage Buffer: Tris-based buffer with 50% glycerol, optimized for this protein

Biological Role and Significance

Apocytochrome f is a crucial component of the cytochrome b6f complex in the thylakoid membranes of chloroplasts . This complex mediates electron transfer between Photosystem II and Photosystem I, which is vital for photosynthesis .

Applications

Recombinant Oenothera argillicola Apocytochrome f (petA) can be utilized in various applications:

  • ELISA assays: It can be used as an antigen in Enzyme-Linked Immunosorbent Assays (ELISA) .

  • Protein antigen: Useful in diagnostic tests, laboratory research, and immunotherapy .

  • Study of Photosynthesis: Recombinant Apocytochrome f can be employed in biochemical and biophysical studies to elucidate the structure, function, and regulatory mechanisms of the cytochrome b6f complex .

  • Understanding Plant Evolution: The petA gene and its product can be used in evolutionary studies to understand the phylogenetic relationships and adaptive strategies of different plant species .

Extraction and Isolation

Information regarding the extraction and isolation of Oenothera argillicola Apocytochrome f (petA) was not found in the provided documents.

Research Findings

Research on Oenothera species reveals diverse applications and biological activities:

  • Genetic Variation: Studies of Oenothera have explored genetic variation and co-variation in plant traits, characterizing selection and heritability .

  • Anti-inflammatory Activity: Compounds from Oenothera biennis (evening primrose) exhibit anti-inflammatory activity by suppressing IL-6 and TNF-α expression in mouse macrophages .

  • Antimicrobial Effects: Extracts from Oenothera biennis have shown inhibitory effects on Streptococcus mutans, reducing dental caries in rats . The extracts also contain polyphenols with antioxidant activities .

  • Antiproliferative Activity: Certain compounds isolated from Oenothera biennis roots exhibit antiproliferative activity against breast, hepatic, prostate, and leukemia cancer cell lines .

  • Phenolic Enzymes: Genes encoding phenolic enzymes are found across the Oenothera genus, with variations in gene family evolution and distribution among species .

  • Bioactivity: Oenothera speciosa exhibits antihyperglycemic, anti-inflammatory, and antioxidant activities .

Data Table

FeatureDescription
SpeciesOenothera glazioviana (Large-flowered evening primrose) (Oenothera erythrosepala)
UniProt NO.B0Z557
Protein NamesApocytochrome f
Gene NamespetA
Expression Region34-318
ApplicationsELISA, Study of Photosynthesis, Understanding Plant Evolution, Protein antigen
Potential ActivitiesAnti-inflammatory, antimicrobial, antiproliferative, antioxidant, antihyperglycemic (in related species)
Biological SignificanceComponent of the cytochrome b6f complex, essential for photosynthetic electron transfer
StorageStore at -20°C, for extended storage, conserve at -20°C or -80°C . Store working aliquots at 4°C for up to one week .
Storage BufferTris-based buffer, 50% glycerol, optimized for this protein
AA SequenceYPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDRQVKQVLANGKKGGLNVGAVLILPEGFELAPPARISPEMKERIGNPSFQSYRPTKKNILVIGPVPGQKYSEITFPILSPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGIVSKIIRKEKGGYEITITDASDGRQVVDIIPSGPELLVSEGESIKLDQPLTSNPNVGGFGQGDAEVVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
34-318
Protein Length
Full Length of Mature Protein
Species
Oenothera argillicola (Appalachian evening primrose)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDRQVKQV LANGKKGGLNVGAVLILPEGFELAPPARISPEMKERIGNPSFQSYRPTKKNILVIGPVPG QKYSEITFPILSPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGIVS KIIRKEKGGYEITITDASDGRQVVDIIPSGPELLVSEGESIKLDQPLTSNPNVGGFGQGD AEVVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF
Uniprot No.

Target Background

Function
Recombinant *Oenothera argillicola* Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex facilitates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Oenothera argillicola Apocytochrome f and where is it found?

Apocytochrome f (petA) is a critical protein component encoded in the plastid genome of Oenothera argillicola (Appalachian evening primrose). It functions as part of the cytochrome b6f complex in the photosynthetic electron transport chain. The mature protein consists of approximately 285 amino acids with a 33-residue N-terminal signal sequence that directs the protein to the thylakoid membrane . In its natural context, apocytochrome f is found within the chloroplasts of plant cells, specifically embedded in the thylakoid membrane where it participates in electron transfer during photosynthesis.

What are the optimal storage conditions for Recombinant Oenothera argillicola Apocytochrome f?

For optimal stability and activity retention, Recombinant O. argillicola Apocytochrome f should be stored in a Tris-based buffer containing 50% glycerol at -20°C. For long-term storage, maintaining the protein at -80°C is recommended . It is critical to avoid repeated freeze-thaw cycles as these can lead to protein denaturation and loss of activity. For routine experimental work, prepare small working aliquots that can be stored at 4°C for up to one week . When handling the protein, minimize exposure to extreme pH conditions and strong oxidizing or reducing agents that might affect the heme group and protein structure.

How can researchers efficiently incorporate Recombinant Oenothera argillicola Apocytochrome f into ELISA-based experiments?

For ELISA applications, researchers should follow this optimized protocol:

  • Coating: Dilute the recombinant Apocytochrome f to 2 μg/mL in PBS (pH 7.4) and coat microplates with 50 μL per well. Incubate overnight at 4°C to ensure optimal protein adsorption .

  • Blocking: Wash plates 3 times with PBS containing 0.1% Tween 20, then block with PBS containing 5% skim milk for 2 hours at room temperature .

  • Primary antibody incubation: Apply diluted primary antibodies specific to the target epitopes and incubate at 37°C for 1-2 hours.

  • Secondary antibody application: After washing, add appropriate HRP-conjugated secondary antibodies (typically at 1:2000-1:5000 dilution) and incubate for 1 hour at 37°C .

  • Detection: Develop using o-phenylenediamine with H₂O₂ as substrate, allowing the reaction to proceed for 15 minutes before stopping and measuring absorbance .

When establishing this assay, researchers should perform preliminary experiments to determine optimal concentrations and incubation times specific to their research questions.

How conserved is Apocytochrome f across plant species, and what does this tell us about its evolutionary significance?

Apocytochrome f exhibits remarkable evolutionary conservation, with over 80% sequence similarity across diverse plant species including Oenothera hookeri, spinach, wheat, and pea . This high degree of conservation strongly indicates the critical functional importance of this protein in photosynthesis. Comparative genomic analyses show that despite different ecological niches occupied by various plant species, the structural characteristics of cytochrome f remain largely unchanged, suggesting strong purifying selection against amino acid substitutions that might compromise its electron transport function .

The conservation extends beyond the protein sequence to the genomic context. In Oenothera hookeri, the gene for pre-apocytochrome f has been mapped to a 2.4 kbp HindIII fragment of the circular plastid chromosome, positioned distal to the gene for ATP synthase subunit alpha . This genomic organization appears to be relatively consistent across species, though notable genomic inversions distinguish the plastid chromosomes of spinach and Oenothera .

What insights have transcriptomic analyses provided about petA gene evolution in the Oenothera genus?

Recent comparative transcriptomic analyses across 29 Oenothera species have revealed significant heterogeneity in gene family evolution throughout the genus . The section Oenothera exhibits particularly pronounced evolutionary changes in gene families, including those involved in photosynthetic functions. Analysis of 63 transcriptomes producing 2.3 million transcripts and 25.4 Mb of total assembly length per individual has enabled comprehensive mapping of orthologous genes across the genus .

What is the specific role of Apocytochrome f in photosynthetic electron transport?

Apocytochrome f serves as a critical component of the cytochrome b6f complex, which functions as an electron carrier in the thylakoid membrane. This complex mediates electron transfer between photosystem II and photosystem I during the light-dependent reactions of photosynthesis. The mature cytochrome f protein, after acquisition of its heme group, plays a pivotal role in this process.

The functional significance of cytochrome f is evidenced by its structural conservation across diverse plant species and its essential role in maintaining efficient photosynthetic electron flow. The protein contains specific domains that facilitate interaction with plastocyanin, allowing for the transfer of electrons from the cytochrome b6f complex to photosystem I. The N-terminal heme-binding domain is particularly critical for its redox function, containing the characteristic CXXCH motif that coordinates the heme group .

How is Apocytochrome f post-translationally processed and integrated into the thylakoid membrane?

The petA gene encodes pre-apocytochrome f, which undergoes several post-translational modifications to become functional mature cytochrome f. Based on research with Oenothera hookeri, the process involves:

  • Signal peptide cleavage: The N-terminal transit peptide (33 amino acids in Oenothera species, compared to 35 in spinach, wheat, and pea) guides the protein to the chloroplast and is cleaved upon import .

  • Heme attachment: The apocytochrome f (protein without heme) receives a covalently attached heme group at a conserved CXXCH motif, transforming it into holocytochrome f.

  • Membrane integration: The mature protein is integrated into the thylakoid membrane through a C-terminal transmembrane domain. Research indicates that plastid-encoded components of the cytochrome bf complex follow specific integration pathways into thylakoid membranes .

  • Complex assembly: The mature cytochrome f assembles with other subunits to form the functional cytochrome b6f complex.

Disruptions in this processing pathway, as observed in some plastome mutants, can affect both chloroplast and nuclear DNA-encoded plastid proteins, highlighting the complex coordination between nuclear and plastid genomes in protein maturation .

How can researchers utilize Recombinant Oenothera argillicola Apocytochrome f to study photosynthetic complex assembly?

Advanced researchers can employ recombinant Apocytochrome f to investigate the intricate process of photosynthetic complex assembly through several sophisticated approaches:

  • In vitro reconstitution experiments: Purified recombinant Apocytochrome f can be combined with other purified components of the cytochrome b6f complex under controlled conditions to study assembly kinetics and requirements. This approach allows researchers to identify critical interaction domains and assembly intermediates by using site-directed mutagenesis to modify specific regions of the protein .

  • Protein-protein interaction analyses: Techniques such as surface plasmon resonance, isothermal titration calorimetry, or pull-down assays using the recombinant protein can identify binding partners and quantify interaction affinities with other components of the photosynthetic apparatus.

  • Structural biology applications: The purified recombinant protein can be utilized for crystallography or cryo-EM studies to determine high-resolution structures that provide insight into the molecular basis of complex assembly.

  • In vitro heme attachment studies: Researchers can investigate the mechanisms of cofactor attachment by combining recombinant Apocytochrome f with purified heme and potential catalytic proteins to reconstitute the holocytochrome formation process.

  • Comparative studies: By examining multiple variants of the protein from different Oenothera species that show variations in photosynthetic efficiency, researchers can correlate sequence variations with functional differences in complex assembly.

What biophysical techniques are most effective for studying the structural dynamics of Recombinant Oenothera argillicola Apocytochrome f?

For investigating the structural dynamics of this protein, researchers should consider this methodological framework:

Each of these approaches offers different but complementary information about the structural dynamics of Apocytochrome f, especially when combined with functional assays to correlate structural changes with electron transfer activity.

What are the most common challenges in expressing and purifying functional Recombinant Oenothera argillicola Apocytochrome f?

Researchers commonly encounter several technical challenges when working with this protein:

  • Codon optimization issues: The plant-specific codon usage in Oenothera argillicola may not be optimal for expression in common laboratory systems such as E. coli or insect cells. Successful expression often requires codon optimization for the host system, as demonstrated in baculovirus-based expression systems similar to those used for other complex proteins .

  • Proper folding and solubility: As a membrane-associated protein, Apocytochrome f tends to aggregate when overexpressed. This challenge can be addressed by:

    • Using fusion tags (such as MBP or SUMO) to enhance solubility

    • Employing speciality E. coli strains designed for membrane proteins

    • Expressing the protein at lower temperatures (16-18°C) to slow folding

    • Including appropriate detergents or lipid environments during purification

  • Heme incorporation: Obtaining proper heme incorporation is essential for functional studies. In recombinant systems, this often requires supplementation with δ-aminolevulinic acid to enhance heme biosynthesis or co-expression with heme lyase to facilitate attachment.

  • Maintaining native conformation: Without the proper membrane environment, the protein may not adopt its native conformation. Reconstitution into nanodiscs or liposomes post-purification can help maintain functional structure.

How can researchers validate the structural integrity and functional activity of purified Recombinant Oenothera argillicola Apocytochrome f?

A comprehensive validation protocol should include:

  • Spectroscopic analysis: UV-visible spectroscopy to confirm proper heme incorporation, with characteristic absorption peaks at approximately 410 nm (Soret band) and 530-560 nm (α/β bands). The reduced versus oxidized spectra provide critical information about heme environment.

  • Redox potential measurements: Using techniques such as cyclic voltammetry or spectroelectrochemistry to determine if the recombinant protein exhibits the expected redox potential (approximately +350 mV vs. standard hydrogen electrode).

  • Electron transfer activity assays: In vitro assays measuring electron transfer rates between the recombinant cytochrome f and physiological partners such as plastocyanin can confirm functional activity.

  • Mass spectrometry: To verify protein identity, integrity, and potential post-translational modifications. This can be particularly useful for confirming the presence of the heme group and its covalent attachment.

  • Circular dichroism: To assess secondary structure content and compare with predicted values based on homology modeling or known structures of cytochrome f from other species.

  • Thermal shift assays: To evaluate protein stability and the effects of buffer conditions, providing information about optimal storage and experimental conditions.

This multi-faceted approach ensures that the recombinant protein maintains both structural and functional integrity required for meaningful experimental results.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.