Recombinant Oenothera argillicola ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its implementation.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Oenothera argillicola (Appalachian evening primrose)
Target Names
atpI
Target Protein Sequence
MDVLSCSNNTLKGLYDISGVEVGQHFYWQIGGFQVHGQVLITSWVVIAILLGSASIAVRN PQTIPNDSQNFFEYILEFIRDVSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKLV ELPHGELAAPTNDINTTVALALLTSVAYFYAGLSKKGLGYFSKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function
A key component of the proton channel, directly involved in proton translocation across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Oenothera argillicola ATP synthase subunit a, chloroplastic (atpI)?

ATP synthase subunit a, chloroplastic (atpI) from Oenothera argillicola (Appalachian evening primrose) is a membrane protein component of the F0 sector of the ATP synthase complex. This subunit is encoded by the chloroplast gene atpI and plays a crucial role in proton translocation across the thylakoid membrane during photosynthetic ATP synthesis. The full-length protein consists of 247 amino acids and contains multiple transmembrane helices that form part of the proton channel. In the ATP synthase complex, subunit a works in conjunction with the rotating c-ring to convert the proton motive force into mechanical energy, which is then utilized by the F1 sector for ATP synthesis .

How does atpI function within the ATP synthase complex?

The atpI subunit serves as a critical component of the proton translocation machinery within the ATP synthase complex. It contains two half-channels that guide protons from the thylakoid lumen to the rotating c-ring and then from the c-ring to the stromal side of the membrane. Unlike the c-subunits that form a rotating ring structure, subunit a remains stationary as part of the stator complex. The interface between subunit a and the c-ring creates the pathway for proton movement, coupling the energy of proton flow down an electrochemical gradient to the mechanical rotation of the c-ring .

During photosynthesis, light-driven electron transport acidifies the thylakoid lumen, creating a proton gradient across the thylakoid membrane. Protons flow through the half-channels in subunit a, interacting with the proton-binding sites on the c-subunits. This proton movement drives the rotation of the c-ring, which is mechanically coupled to the central stalk of the ATP synthase. The rotation of the central stalk induces conformational changes in the catalytic F1 sector, leading to ATP synthesis from ADP and inorganic phosphate .

What expression systems are optimal for recombinant atpI production?

For successful production of recombinant Oenothera argillicola atpI, researchers should consider these methodological approaches:

  • E. coli expression systems: The most widely used platform, with T7 Express lysY/Iq strains showing good results for membrane proteins .

  • Expression vectors: Constructs with N-terminal His-tags facilitate downstream purification while minimizing interference with membrane insertion .

  • Induction conditions: Lower temperatures (16-20°C) and reduced IPTG concentrations (0.1-0.5 mM) often increase proper folding of membrane proteins.

  • Co-expression strategies: Including chaperone proteins such as DnaK, DnaJ, and GrpE significantly improves yield and proper folding of difficult membrane proteins like atpI .

  • Cell lysis optimization: Gentle lysis methods that preserve membrane integrity prior to detergent solubilization are critical for maintaining protein structure.

When establishing a new expression system, researchers should conduct small-scale optimization experiments testing multiple E. coli strains, induction conditions, and lysis protocols before scaling up to preparative quantities. Expression levels should be monitored via Western blotting, as membrane proteins often express at lower levels than soluble proteins .

What purification strategies yield the highest quality recombinant atpI?

Purification of recombinant His-tagged atpI requires careful optimization to maintain protein integrity. An effective purification workflow includes:

  • Membrane isolation: Separate membrane fractions by ultracentrifugation after cell lysis.

  • Detergent selection: Screen multiple detergents (DDM, LDAO, octylglucoside) for optimal solubilization without denaturation .

  • IMAC purification: Use Ni-NTA or cobalt-based resins with carefully optimized imidazole concentrations in both wash and elution buffers.

  • Buffer composition: Include stabilizers such as glycerol (10-20%) and trehalose (6%) to maintain protein stability throughout purification .

  • Quality control: Assess purity by SDS-PAGE (aiming for >90%) and proper folding by circular dichroism spectroscopy.

Critical parameters to monitor include detergent:protein ratios, imidazole concentration gradients, and temperature during purification steps. The final purified protein should be stored in small aliquots at -20°C/-80°C to prevent repeated freeze-thaw cycles that can lead to aggregation and loss of activity .

How can researchers assess the functional integrity of purified atpI?

Validating the functional integrity of purified recombinant atpI is essential before proceeding to detailed mechanistic studies. Methodological approaches include:

  • Liposome reconstitution: Incorporating purified atpI into liposomes with defined lipid composition (typically phosphatidylcholine and phosphatidylethanolamine mixtures).

  • Proton translocation assays: Using pH-sensitive fluorescent dyes (e.g., ACMA or pyranine) to measure proton movement across reconstituted membranes.

  • Co-reconstitution experiments: Combining atpI with purified c-subunits to recreate the minimal functional unit for proton translocation .

  • Binding partner interaction studies: Assessing interaction with other ATP synthase components through co-immunoprecipitation or surface plasmon resonance.

  • Comparative analysis: Testing the activity under varying conditions (pH, temperature, ion concentrations) to establish functional parameters.

Researchers should include appropriate controls in each experiment, such as liposomes without protein, heat-denatured protein samples, and known inhibitors of proton translocation. Quantitative analysis of proton flux rates under different conditions provides the most robust assessment of functional integrity .

How can site-directed mutagenesis of atpI advance understanding of proton translocation mechanisms?

Site-directed mutagenesis of recombinant atpI offers powerful insights into the molecular mechanisms of proton translocation. Research should follow these methodological approaches:

  • Target selection: Prioritize conserved charged residues in predicted transmembrane regions, particularly those analogous to functionally important residues identified in bacterial systems (e.g., equivalents to Lys-180 and Arg-210 in bacterial ATP synthases) .

  • Mutation strategy: Design a systematic panel of mutations including:

    • Conservative substitutions (e.g., Lys→Arg) to test charge importance

    • Non-conservative substitutions (e.g., Lys→Ala) to test side chain requirement

    • Charge reversals (e.g., Lys→Glu) to test electrostatic interactions

  • Functional characterization: Assess each mutant for:

    • Expression levels and membrane integration

    • Proton translocation efficiency in reconstituted systems

    • pH-dependent activity profiles

    • Interactions with c-subunits

Previous research on bacterial ATP synthases has demonstrated that mutations at positions equivalent to Lys-180 result in diverse functional effects depending on pH conditions. For example, replacing lysine with alanine, glycine, or histidine impaired ATP synthesis at both high (pH 10.5) and near-neutral (pH 7.5) conditions, while arginine substitution resulted in pH-dependent effects . Extending such analyses to chloroplastic atpI would reveal conserved mechanisms and unique adaptations in photosynthetic ATP synthases.

What insights can comparative analysis of Oenothera species provide?

Comparative analysis of atpI across Oenothera species offers unique research opportunities:

  • Sequence conservation analysis: Interestingly, Oenothera argillicola and Oenothera glazioviana possess identical atpI amino acid sequences despite being classified as different species . This perfect conservation suggests:

    • Strong evolutionary constraints on atpI structure and function

    • Potential recent speciation or taxonomic complexity within Oenothera

    • Critical functional importance of the exact sequence for chloroplast ATP synthase

  • Structure-function correlation: By comparing sequences with functional data across species:

    • Identify invariant residues essential for basic function

    • Correlate sequence variations with biochemical adaptations

    • Map conservation patterns onto structural models

  • Evolutionary studies: The Oenothera genus presents unique opportunities to study chloroplast genome evolution due to its unusual genetic system including biparental inheritance of plastids in some species.

  • Methodological approaches: Researchers should combine:

    • Phylogenetic analysis of atpI sequences across multiple Oenothera species

    • Functional characterization of recombinant proteins from different species

    • Chimeric protein construction to identify functionally important regions

The identical sequences observed in O. argillicola and O. glazioviana provide a natural control for studying how nuclear genome differences might influence ATP synthase assembly and regulation despite identical chloroplast components .

How can structural biology techniques be applied to chloroplastic atpI research?

Structural characterization of chloroplastic atpI presents technical challenges but offers tremendous research value. Methodological approaches include:

  • Cryo-electron microscopy (cryo-EM): The most promising approach for membrane proteins like atpI.

    • Sample preparation: Reconstitution into nanodiscs or amphipols to mimic the membrane environment

    • Data collection: High-resolution imaging of multiple particle orientations

    • Image processing: Classification and refinement to achieve sub-4Å resolution

  • Cross-linking coupled with mass spectrometry: To identify:

    • Interaction surfaces between atpI and other subunits

    • Conformational changes under different conditions

    • Spatial relationships between key functional residues

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Maps solvent-accessible regions and dynamic elements

    • Identifies potential proton pathways through the protein

    • Detects conformational changes in response to pH or mutations

  • Molecular dynamics simulations:

    • Model proton movement through the half-channels

    • Predict effects of mutations on channel architecture

    • Simulate interactions with the c-ring during proton translocation

Each approach has specific technical requirements for sample preparation and data analysis. For cryo-EM studies, particular attention should be paid to detergent selection, protein concentration, and grid preparation techniques to achieve high-resolution structural information .

What are common challenges in recombinant atpI research and how can they be addressed?

Researchers working with recombinant atpI commonly encounter several technical challenges:

  • Low expression yields:

    • Problem: Membrane proteins often express poorly in heterologous systems

    • Solution: Optimize codon usage for E. coli, reduce expression temperature to 16-20°C, and co-express with chaperones like DnaK, DnaJ, and GrpE

  • Protein aggregation:

    • Problem: Improper folding leading to inclusion body formation

    • Solution: Screen multiple detergents at varying concentrations; include stabilizing agents like glycerol and trehalose in buffers

  • Loss of function during purification:

    • Problem: Detergent-mediated disruption of native structure

    • Solution: Use milder detergents (DDM instead of SDS); minimize time between membrane extraction and reconstitution

  • Inconsistent reconstitution:

    • Problem: Variable incorporation into liposomes

    • Solution: Standardize lipid composition and protein:lipid ratios; use controlled dehydration-rehydration cycles

  • Difficult data interpretation:

    • Problem: Distinguishing specific activity from artifacts

    • Solution: Include appropriate controls (empty liposomes, denatured protein); perform concentration-dependent activity measurements

For each challenge, systematic optimization with small-scale experiments before scaling up can save significant time and resources. Documenting detailed protocols with specific buffer compositions, incubation times, and temperature conditions is essential for reproducibility .

How should researchers interpret conflicting functional data for ATP synthase components?

When confronted with conflicting functional data for ATP synthase components like atpI, researchers should apply these methodological principles:

  • Context-dependent function analysis: ATP synthase components may behave differently depending on:

    • pH environment (as seen with Lys-180 mutants functioning differently at pH 7.5 vs. 10.5)

    • Lipid environment (membrane composition affects protein function)

    • Presence of other subunits (isolated vs. complex-incorporated behavior)

  • Methodology-based variation assessment: Different techniques may yield apparently conflicting results due to:

    • Sensitivity differences between assays

    • Direct vs. indirect measurement approaches

    • In vitro vs. in vivo conditions

  • Research design for resolution:

    • Test hypotheses under multiple conditions

    • Apply complementary methodologies to the same samples

    • Carefully control variables between experiments

For example, research on ATP synthase a-subunits from alkaliphilic bacteria showed that a lysine residue (K180) played different functional roles depending on pH. Initial hypotheses based on data from one species suggested that K180-containing synthases might not function at neutral pH, but studies in Bacillus pseudofirmus OF4 demonstrated robust function across a broad pH range, revealing context-dependent functional properties .

What innovations in recombinant protein technology could advance atpI research?

Several emerging technologies hold promise for advancing recombinant atpI research:

  • Cell-free expression systems:

    • Allow direct incorporation into liposomes during synthesis

    • Bypass toxicity issues associated with membrane protein overexpression

    • Enable rapid testing of multiple constructs

  • Novel membrane mimetics:

    • Nanodiscs with defined size and composition

    • Styrene-maleic acid lipid particles (SMALPs) for detergent-free extraction

    • Peptidisc scaffolds for membrane protein stabilization

  • Advanced labeling approaches:

    • Unnatural amino acid incorporation for site-specific probes

    • Click chemistry for selective modification post-purification

    • Segmental isotopic labeling for NMR studies

  • High-throughput functional screening:

    • Microfluidic platforms for parallel functional assessment

    • Fluorescence-based assays adaptable to plate reader formats

    • Automated reconstitution and measurement systems

  • Computational advances:

    • Improved structure prediction through AI/machine learning

    • Molecular dynamics simulations with enhanced sampling techniques

    • Systems biology models integrating ATP synthase function with other cellular processes

These innovations could address current bottlenecks in atpI research, particularly the challenges of obtaining sufficient quantities of properly folded protein and performing detailed structure-function analyses in membrane environments that mimic the native thylakoid membrane .

What are unresolved questions about chloroplastic atpI function?

Despite decades of research on ATP synthases, several fundamental questions about chloroplastic atpI remain unresolved:

  • Proton pathway architecture: The precise three-dimensional arrangement of the proton half-channels in chloroplastic atpI has not been definitively established, limiting our understanding of the detailed proton translocation mechanism.

  • Species-specific adaptations: How chloroplastic atpI variants have evolved to function under different physiological conditions (varying light intensities, temperature ranges, etc.) remains largely unexplored.

  • Regulatory mechanisms: The potential roles of atpI in regulation of ATP synthase activity beyond its core proton translocation function are poorly understood.

  • Assembly process: The biogenesis pathway of atpI and its incorporation into the complete ATP synthase complex in chloroplasts requires further investigation.

  • Interactions with lipids: The specific lipid requirements for optimal atpI function and how lipid composition affects proton translocation efficiency remain to be determined.

Addressing these questions will require innovative approaches combining recombinant protein technology, advanced structural methods, and in vivo functional studies .

How could recombinant atpI be applied to synthetic biology and biotechnology?

Recombinant atpI has several potential applications in synthetic biology and biotechnology:

  • Bioenergetic modules: Engineering minimal ATP-generating systems by combining recombinant atpI with other ATP synthase components in synthetic vesicles.

  • Biosensors: Developing proton flux sensors based on atpI incorporated into detector systems for monitoring bioenergetic processes or environmental pH changes.

  • Biomimetic energy systems: Creating artificial photosynthetic systems coupling light-harvesting modules with ATP-generating components including recombinant atpI.

  • Drug screening platforms: Establishing assay systems to identify compounds that modulate proton translocation, with potential applications in herbicide development or treatment of mitochondrial disorders.

  • Educational models: Developing synthetic protein systems demonstrating chemiosmotic coupling principles for research training and education.

The successful implementation of these applications depends on efficient production and functional reconstitution of recombinant atpI, highlighting the importance of optimizing the methodologies discussed in earlier sections .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.