Recombinant Oenothera argillicola Cytochrome c biogenesis protein ccsA (ccsA)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Oenothera argillicola Cytochrome c biogenesis protein ccsA (ccsA) is a genetically engineered protein critical for cytochrome c assembly, a process essential for electron transport in photosynthesis and respiration. This protein is produced by expressing the ccsA gene from O. argillicola in heterologous systems such as E. coli, enabling large-scale purification for research and industrial applications .

Gene Information

  • Gene Name: ccsA (Cytochrome c biogenesis protein ccsA)

  • UniProt ID: B0Z4S4

  • Genomic Context: Located in the small single-copy (SSC) region of the chloroplast genome, adjacent to ndhD and rpl32 in Oenothera species .

Protein Structure

  • Amino Acid Sequence: Full-length (1–319 aa) with an N-terminal His tag for affinity purification .

  • Molecular Function: Facilitates heme attachment to apocytochrome c during cytochrome c maturation .

Table 1: Key Features of Recombinant ccsA

PropertyDetails
Host SystemE. coli, Yeast, Baculovirus, Mammalian Cells
Purity≥85% (SDS-PAGE verified)
TagN-terminal His tag
Gene StabilityHigh conservation across Oenothera species, intron-free structure

Recombinant Expression

The ccsA gene is cloned into expression vectors and introduced into host systems. E. coli is preferred for cost-effectiveness and high yield .

Purification Workflow

  1. Cell Lysis: Sonication or enzymatic disruption.

  2. Affinity Chromatography: Ni-NTA resin exploits the His tag for binding.

  3. Buffer Exchange: Dialysis into storage buffers (e.g., Tris-HCl, pH 8.0) .

Table 2: Expression Systems Comparison

HostYield (mg/L)PurityAdvantages
E. coli10–50≥85%Cost-effective, scalable
Baculovirus5–20≥90%Post-translational modifications

Evolutionary Insights

  • Chloroplast Genome Analysis: The ccsA gene in O. argillicola exhibits structural stability despite intron loss in related genes like clpP, which lost both introns in Oenothera sect. Oenothera .

  • Selective Pressure: The ccsA gene has a low Ka/Ks ratio (<0.5), indicating purifying selection to preserve function .

Functional Studies

  • Cytochrome c Maturation: Recombinant ccsA binds heme and catalyzes its ligation to apocytochrome c, confirmed via in vitro assays .

  • Biotechnological Applications: Used in metabolic engineering to enhance electron transport efficiency in synthetic biology systems .

Comparative Genomics

The ccsA gene is flanked by ndhD and rpl32 in the SSC region of O. argillicola’s chloroplast genome. Comparative studies highlight:

Table 3: Genomic Variations in ccsA Across Oenothera Species

SpeciesIntron StatusGenomic PositionNotable Features
O. argillicolaIntactSSC (rpl32-ccsA)High codon bias for stability
O. lindheimeriIntron lossSSC (ndhF-rpl32)Linked to clpP degradation

Challenges and Future Directions

  • Structural Resolution: No crystallographic data exists for O. argillicola ccsA; cryo-EM studies are needed .

  • Ecological Adaptation: Role of ccsA in O. argillicola’s adaptation to high-stress environments remains unexplored .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributors.
Note: All protein shipments are sent with standard blue ice packs. If dry ice shipment is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ccsA; Cytochrome c biogenesis protein CcsA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Oenothera argillicola (Appalachian evening primrose)
Target Names
ccsA
Target Protein Sequence
MIFYTLEHILTHISFSLVSIGITIFLITLSVDEIIGLYDSSEKGVIGTFLCITGLLVTRW AYSGHFPLSNLYESLLFLSWSFAIIHMFPYLKKQKSYVRTITSSSTIFTQGLVTSGLLSE MQQSEILVPALQSQWLMMHVSMMVLGYAALLCGSLLSVALLVITFRKALKIFSKKKAFLK DSFSFVEIQYRNEPSNVLLSTSFISSKNYYRAQLIQQLDRWSSRIISLGFIFLTIGILSG AVWANEAWGSYWNWDPKETWAFITWTMFAIYLHTRTNPNFQSVNSAIVAFLGFIIIWICY FGVNLLGIGLHSYGSFNLH
Uniprot No.

Target Background

Function
This protein is crucial in the biogenesis of c-type cytochromes (cytochrome c6 and cytochrome f) during the heme attachment step.
Protein Families
CcmF/CycK/Ccl1/NrfE/CcsA family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the CcsA protein and what is its role in cytochrome c biogenesis?

CcsA is a key membrane protein component of the cytochrome c biogenesis System II pathway, which is responsible for the maturation of c-type cytochromes in certain bacteria, cyanobacteria, and plant chloroplasts. CcsA functions in heme delivery and export across membranes, and together with CcsB, forms the cytochrome c synthase complex that catalyzes the stereospecific covalent attachment of heme to the apocytochrome c . The biogenesis process involves the periplasmic reduction of cysteine residues in the heme c attachment motif, transmembrane transport of heme b, and formation of thioether bonds . CcsA contains a highly conserved tryptophan-rich region called the WWD domain that is proposed to be involved in heme binding, along with two conserved histidine residues that likely serve as axial ligands to heme iron .

What is Oenothera argillicola and why is it relevant to CcsA research?

Oenothera argillicola (Shale-barren Evening-primrose) is a rare endemic flowering plant found in shale barrens and other challenging habitats in the mid-Appalachians. It is a biennial or perennial herb that can reach 1.5m in height, with yellow flowers and glossy, dark green leaves . The species is considered threatened in Pennsylvania (PT) with a global rank of G3G4 .

Oenothera species are particularly important in plant genetics and evolutionary biology due to their unique plastid genome characteristics and hybridization patterns. The genus Oenothera exhibits interesting features in its chloroplast genome (plastome), including a large inversion of approximately 56 kb in the LSC region that occurred in the intergenic regions between the accD/rbcL and rps16/trnQ UUG genes . This makes Oenothera, including O. argillicola, valuable for studying chloroplast evolution, cytochrome c biogenesis, and plant speciation mechanisms.

What are the key functional domains and conserved residues in CcsA?

The CcsA protein contains several key functional domains and conserved residues that are critical for its role in cytochrome c biogenesis:

  • WWD Domain: A highly conserved, tryptophan-rich region that is proposed to be involved in heme binding .

  • Conserved Histidine Residues: CcsA contains three histidine residues that are strictly conserved and essential for function:

    • His212 and His347: Located on the lumen side of the membrane

    • His309: Located on the stromal side of the membrane

  • Transmembrane Domains: CcsA is an integral membrane protein with multiple transmembrane domains that facilitate heme transport across the membrane.

  • External Heme Binding Domain: Formed by two external histidines flanking the WWD domain, this domain binds reduced (Fe2+) heme. When either of these histidines is mutated, the absorption spectrum of the heme in CcsBA is dramatically perturbed, and the heme iron becomes oxidized (Fe3+) .

Functional analysis through site-directed mutagenesis has established the absolute requirement of all three conserved histidines for the assembly of plastid c-type cytochromes, demonstrating their critical importance to protein function .

How does the topological organization of CcsA contribute to its function?

Topological analysis of plastid CcsA using PhoA and LacZalpha reporters has revealed that the WWD motif and the conserved residues His212 and His347 are positioned on the lumen side of the membrane, while His309 is located on the stromal side . This specific arrangement is crucial for CcsA's function in relaying heme from the stroma to the lumen.

The proposed model suggests that CcsA operates in conjunction with Ccs1 to form a cytochrome c assembly machinery. In this model, the WWD motif and histidine residues work together to transport heme across the membrane, with the histidines likely serving as axial ligands to the heme iron during transport . This topological organization enables CcsA to:

  • Capture heme on the stromal side via His309

  • Transport heme through the membrane via the WWD domain

  • Present heme on the lumen side via His212 and His347 for attachment to the apocytochrome c

This arrangement facilitates the directional transport of heme and its protection from oxidation during the transport process .

What methods are most effective for recombinant expression and purification of CcsA protein?

Based on successful experimental approaches documented in the literature, the following methods are most effective for recombinant expression and purification of CcsA protein:

  • Expression System:

    • Use of fused CcsBA polypeptides rather than individual CcsA protein, as demonstrated with the H. hepaticus CcsBA, which exhibited high cytochrome c4 synthetase activity

    • Expression as an N-terminal fusion to GST in E. coli systems

  • Solubilization and Purification:

    • Solubilization in n-dodecyl β-d-maltoside (DDM)

    • Affinity purification using GST-based chromatography

    • Purification to >95% purity can be achieved

  • Protein Assessment:

    • SDS-PAGE analysis to verify protein integrity

    • Heme detection using chemiluminescent staining

    • N-terminal sequencing for confirmation of protein identity

It's noteworthy that CcsB has natural proteolytic susceptibility, which can be advantageous for analysis and localization of heme within CcsA. The CcsA portion (labeled as CcsA*) copurifies with the GST-tagged CcsB portion (GSTCcsB*) with equimolar stoichiometry, indicating the tight complex that CcsB and CcsA form .

What techniques can be used to analyze the heme-binding properties of CcsA?

Several techniques have been successfully employed to analyze the heme-binding properties of CcsA:

  • Absorption Spectroscopy:

    • Purified CcsBA preparations appear red, suggesting heme binding

    • Absorption spectra can detect perturbations when conserved histidines are mutated

    • Can distinguish between reduced (Fe2+) and oxidized (Fe3+) states of heme

  • Chemiluminescent Heme Detection:

    • Used to specifically detect heme in purified protein preparations

  • Site-Directed Mutagenesis:

    • Mutation of conserved histidines to assess their role in heme binding

    • Analysis of how mutations affect heme protection from oxidation

  • Heme Export Assays:

    • Techniques to measure the translocation of heme from its site of synthesis in the cytoplasm to the external heme binding domain

    • Assessment of the role of conserved TMD histidines in this process

  • In vivo Functional Assays:

    • Use of B. pertussis cytochrome c4 as a reporter for cytochrome c assembly

    • Assessment of CcsA function by its ability to replace the system I pathway in E. coli

    • Use of the ferrochelatase inhibitor N-methylprotoporphyrin to modulate heme levels in vivo

These techniques collectively provide insights into how CcsA binds heme, protects it from oxidation, and exports it across membranes for cytochrome c assembly.

How does the CcsA protein from Oenothera argillicola compare to CcsA from other species?

While the search results don't provide direct comparison data specific to O. argillicola CcsA versus other species, we can infer information based on general conservation patterns of CcsA across species:

The CcsA protein is generally well-conserved across different organisms that utilize the System II pathway for cytochrome c biogenesis, including β-, δ-, and ε-proteobacteria, Gram-positive bacteria, Aquificales, cyanobacteria, and plant/algal chloroplasts .

Key conserved features across species include:

Some species-specific variations exist:

  • Some ε-proteobacteria (including Helicobacter hepaticus, Helicobacter pylori, Bordetella pertussis, and Bacteroides thetaiotaomicron) contain CcsBA fusion proteins, which constitute single polypeptide cytochrome c synthases .

  • The H. hepaticus CcsBA exhibits high cytochrome c4 synthetase activity and has been successfully used for detailed biochemical studies .

  • Different species may show variations in the affinity for heme, as suggested by the observation that "System II uses a single protein (CcsA) for haem delivery, and our data suggest a significantly lower affinity for haem for the CcsA protein" .

What insights can be gained from studying CcsA in the context of Oenothera's unique plastome characteristics?

Studying CcsA in the context of Oenothera's unique plastome characteristics provides several valuable insights:

  • Evolutionary Adaptations: Oenothera species, including O. argillicola, possess distinctive plastome features, such as a large inversion of ~56 kb in the LSC region between the accD/rbcL and rps16/trnQ UUG genes . This genomic rearrangement may influence the expression and function of plastid proteins, including those involved in cytochrome c biogenesis.

  • Species-Specific Regulation: O. argillicola shows unique characteristics at the IRA/SSC border of its plastome, where the ψycf1 gene is absent, and instead, the ndhF gene extends across the border . Such genomic rearrangements may affect the regulation of genes involved in energy metabolism and potentially influence cytochrome c biogenesis.

  • Hybrid Incompatibility: Oenothera species are known for their constant hybrid nature and nuclear-plastome incompatibilities, which make them excellent models for studying the role of plastids in speciation . The function of CcsA and its interaction with nuclear-encoded factors may be a critical aspect of these incompatibilities.

  • Adaptation to Environmental Stress: O. argillicola is adapted to harsh environments like shale barrens , which may require specific adjustments in its energy metabolism, including potential modifications to the cytochrome c biogenesis system to optimize energy production under stress conditions.

  • Chloroplast Mutation Patterns: Spontaneous chloroplast mutations occur with a frequency of 0.3% in Oenothera , and understanding how these mutations affect CcsA function could provide insights into the plasticity and robustness of the cytochrome c biogenesis system.

How does the heme delivery mechanism of CcsA in System II differ from other cytochrome c biogenesis systems?

The heme delivery mechanism of CcsA in System II differs from other cytochrome c biogenesis systems in several key aspects:

  • System II vs. System I:

    • System II uses a single protein (CcsA) for heme delivery, while System I employs a more complex machinery

    • System II exhibits a lower affinity for heme compared to System I

    • System I can utilize endogenous heme at much lower levels than System II

  • Heme Chaperone Differences:

    • System I encodes a covalently bound heme chaperone (holo-CcmE) that can act as a heme reservoir

    • No covalent intermediate has been found in System II, which lacks this heme reservoir capability

  • Protein Components:

    • System II comprises four (sometimes only three) membrane-bound proteins: CcsA (or ResC), CcsB (ResB), CcdA, and CcsX (ResA)

    • CcsA and CcsB form the cytochrome c synthase, while CcdA and CcsX function in generating a reduced heme c attachment motif

  • Fusion Proteins:

    • Some ε-proteobacteria contain CcsBA fusion proteins forming single polypeptide cytochrome c synthases

    • The CcsBA fusion can functionally replace the eight-gene system I pathway in E. coli, demonstrating that the CcsB and CcsA membrane complex likely possesses both heme delivery and periplasmic cytochrome c-heme ligation functions

  • Heme Export Mechanism:

    • CcsBA binds reduced (Fe2+) heme in an "external heme binding domain" composed of two external histidines flanking the WWD domain

    • These histidines serve as axial ligands to the heme iron and protect it from oxidation

    • Two conserved TMD histidines in CcsBA are required for translocation of reduced heme from the cytoplasm to the external heme binding domain

What are the challenges and solutions in establishing a robust heterologous expression system for O. argillicola CcsA?

Establishing a robust heterologous expression system for O. argillicola CcsA presents several challenges and potential solutions:

Challenges:

  • Membrane Protein Expression: As an integral membrane protein, CcsA is challenging to express and purify in functional form.

  • Specific Folding Requirements: The complex topology of CcsA, with multiple transmembrane domains and critically positioned histidine residues, requires proper folding for function.

  • Heme Incorporation: Ensuring proper heme binding and maintaining it in the reduced (Fe2+) state during expression and purification.

  • Interaction with CcsB: CcsA functions in a complex with CcsB, and expressing CcsA alone may not yield a functional protein.

  • Plant-Specific Post-Translational Modifications: Potential plant-specific modifications may be necessary for optimal function.

Solutions:

  • Fusion Protein Approach: Express CcsA as part of a CcsBA fusion protein, which has been successfully used with homologs from other species like H. hepaticus .

  • Codon Optimization: Adapt the coding sequence to the codon usage of the expression host to improve translation efficiency.

  • Expression Host Selection: Use E. coli strains optimized for membrane protein expression or consider plant-based expression systems.

  • Fusion Tags and Solubilization Strategies:

    • N-terminal GST fusion has been effective for CcsBA proteins

    • Use appropriate detergents like n-dodecyl β-d-maltoside (DDM) for solubilization

  • Co-expression with Partner Proteins: Express CcsA together with CcsB and potentially other components of the System II pathway.

  • Controlled Heme Availability: Supplement the expression medium with δ-aminolevulinic acid (ALA) to ensure adequate heme biosynthesis, or use a system that allows for controlled heme addition during protein purification.

  • Anaerobic Purification: Perform protein purification under anaerobic conditions to prevent heme oxidation.

What techniques can be used to assess the functional interactions between CcsA and other proteins in the cytochrome c biogenesis pathway?

Several techniques can be employed to assess the functional interactions between CcsA and other proteins in the cytochrome c biogenesis pathway:

  • Co-immunoprecipitation (Co-IP):

    • Can be used to identify physical interactions between CcsA and other components of the cytochrome c biogenesis machinery

    • Has been used to demonstrate the tight complex formed between CcsB and CcsA in B. pertussis and C. reinhardtii

  • Blue Native PAGE (BN-PAGE):

    • Useful for analyzing intact protein complexes

    • Can identify higher-order complexes involving CcsA

    • Has revealed a 200-kDa Ccs1-containing complex in thylakoid membranes that is absent in ccsA mutants, suggesting that CcsA operates together with Ccs1

  • Yeast Two-Hybrid (Y2H) or Bacterial Two-Hybrid Systems:

    • Can detect binary protein-protein interactions

    • Modified versions for membrane proteins would be required for CcsA

  • Genetic Complementation Studies:

    • Using a CcsBA fusion to complement system I deletion mutants in E. coli

    • Can assess functional conservation across different biogenesis systems

  • Site-Directed Mutagenesis Combined with Functional Assays:

    • Mutation of conserved residues in CcsA and assessment of their effect on interaction with other proteins

    • Has established the functional importance of the WWD motif and the absolute requirement of all three histidines

  • Comparative Expression Analysis:

    • Real-time PCR analysis of nuclear and plastid gene expression

    • Can help understand the coordination between nuclear and plastid-encoded components of the cytochrome c biogenesis pathway

  • Protein Crosslinking:

    • Can capture transient interactions between CcsA and other proteins

    • Useful for identifying components that may interact only briefly during the heme delivery process

  • Structural Studies:

    • Techniques like cryo-EM could potentially reveal the structural basis of interactions between CcsA and other proteins in the complex

What strategies can be employed to study the role of CcsA in heme export and protection?

To study the role of CcsA in heme export and protection, researchers can employ several strategies:

  • Site-Directed Mutagenesis of Key Residues:

    • Mutation of the conserved histidine residues (His212, His309, His347) to assess their roles in heme binding and protection

    • Mutation of residues in the WWD domain to determine their contribution to heme handling

    • Analysis of how mutations affect the absorption spectrum of heme and its oxidation state

  • Heme Detection and Spectroscopic Analysis:

    • Use of absorption spectroscopy to monitor heme binding and its oxidation state

    • Chemiluminescent heme detection to track heme association with CcsA

    • Resonance Raman spectroscopy to characterize heme coordination within the protein

  • Heme Transport Assays:

    • Use of fluorescent or radioactively labeled heme analogs to track heme movement

    • Assessment of heme export from inside-out membrane vesicles containing recombinant CcsA

    • Study of heme translocation from the cytoplasm to the external heme binding domain

  • Modulation of Cellular Heme Levels:

    • Use of the ferrochelatase inhibitor N-methylprotoporphyrin to modulate heme levels in vivo

    • Comparison of how System II (with CcsA) versus System I utilizes heme at different concentrations

  • Anaerobic versus Aerobic Conditions:

    • Study of CcsA function under anaerobic versus aerobic conditions to assess oxygen sensitivity

    • Evaluation of how oxygen affects heme oxidation in wild-type versus mutant CcsA proteins

  • In vitro Reconstitution:

    • Purification of CcsA or CcsBA and reconstitution into liposomes

    • Direct assessment of heme transport and protection capabilities

    • Comparison with other heme transport systems

  • Computational Modeling:

    • Molecular dynamics simulations to model heme movement through CcsA

    • Prediction of heme-binding sites and transport pathways

    • Assessment of how mutations might affect these processes

What is the codon usage pattern in Oenothera argillicola and how might it affect recombinant CcsA expression?

While specific codon usage data for O. argillicola is not directly provided in the search results, we can draw inferences from related species in the same order (Myrtales). The following table shows the Relative Synonymous Codon Usage (RSCU) values for several species in the Lythraceae family, which is related to Onagraceae (the family of Oenothera):

Table 1: Relative Synonymous Codon Usage (RSCU) in Selected Myrtales Species

Amino acidCodonD. grandifloraT. natansL. salicariaL. intermisP. granatumW. fruticosaR. rotundifolia
AlaGCU1.751.781.841.631.801.761.72
AlaGCG0.510.440.470.610.460.520.53
AlaGCC0.670.640.610.680.630.670.64
AlaGCA1.071.131.091.091.111.051.10
LeuCUA1.001.241.021.071.021.051.09
LeuCUC0.640.590.640.640.660.690.61
LeuCUG0.550.580.540.580.530.510.53
LeuCUU1.811.591.801.711.791.751.78
LeuUUA1.181.201.181.201.191.181.22
LeuUUG0.820.800.820.800.810.820.78
HisCAC0.500.560.510.510.470.490.55
HisCAU1.501.441.491.491.531.511.45
TrpUGG1.001.001.001.001.001.001.00

Note: This table shows a subset of codons that would be particularly relevant for CcsA expression, focusing on amino acids that are critical for its function (His, Trp) and common amino acids (Ala, Leu) .

For recombinant expression of O. argillicola CcsA, these codon usage patterns suggest:

  • Codon Optimization Strategies:

    • Histidine codons: CAU is strongly preferred over CAC (approximately 3:1 ratio)

    • For leucine, CUU is the most preferred codon, followed by UUA

    • For alanine, GCU is highly preferred, while GCG is least used

  • Expression Host Considerations:

    • When expressing in E. coli, optimization might be necessary as bacterial codon preferences differ

    • For expression in plant systems, closer matching to the natural codon bias may improve yields

  • Critical Residue Expression:

    • Special attention should be paid to the codons used for the conserved histidine and tryptophan residues in the WWD domain, as these are essential for function

What mutations in CcsA have been characterized and what are their functional consequences?

Based on the search results, several mutations in CcsA have been characterized, particularly focusing on the conserved histidine residues and the WWD domain. The following table summarizes these mutations and their functional consequences:

Table 2: Characterized Mutations in CcsA and Their Functional Consequences

MutationProtein RegionFunctional ConsequenceReference
His212 mutationsConserved histidine on lumen side- Absolute loss of function
- Inability to assemble plastid c-type cytochromes
His309 mutationsConserved histidine on stromal side- Absolute loss of function
- Inability to assemble plastid c-type cytochromes
His347 mutationsConserved histidine on lumen side- Absolute loss of function
- Inability to assemble plastid c-type cytochromes
External histidine mutations (CcsBA)External histidines flanking WWD domain- Dramatic perturbation of heme absorption spectrum
- Oxidation of heme iron (Fe³⁺ instead of Fe²⁺)
- Loss of heme protection from oxidation
WWD motif mutationsTryptophan-rich signature motif- Loss of function
- Functional importance for cytochrome c assembly
TMD histidine mutations (CcsBA)Transmembrane domain histidines- Defect in heme translocation from cytoplasm to external binding domain

These findings demonstrate the critical importance of the conserved histidine residues and the WWD motif for CcsA function in cytochrome c biogenesis. The histidines play dual roles:

  • Serving as axial ligands to heme iron

  • Protecting heme from oxidation during transport

Mutations in these residues lead to complete loss of function, highlighting their essential nature for the protein's activity . The data suggest a model where heme is relayed from the stromal to the lumen side of the membrane, with different histidine residues playing specific roles in this process depending on their location.

What are the most promising directions for future research on O. argillicola CcsA?

Based on current knowledge and gaps identified in the research, the following directions appear most promising for future studies on O. argillicola CcsA:

  • Structural Studies:

    • Determination of the three-dimensional structure of CcsA or the CcsBA complex

    • Characterization of conformational changes during heme transport

    • Identification of specific binding sites for heme and interaction partners

  • Mechanistic Studies of Heme Transport:

    • Detailed investigation of the step-by-step process of heme movement through CcsA

    • Elucidation of how reduced heme is maintained during transport

    • Determination of rate-limiting steps in the transport process

  • Integration with Nuclear-Encoded Factors:

    • Investigation of how nuclear-encoded proteins interact with CcsA in O. argillicola

    • Understanding how nuclear-plastid interactions influence cytochrome c biogenesis

    • Exploration of potential nuclear-plastid incompatibilities involving CcsA

  • Evolutionary Studies:

    • Comparative analysis of CcsA across Oenothera species with different plastome types

    • Investigation of how CcsA has adapted to the unique plastome features of Oenothera

    • Assessment of CcsA evolution in the context of Oenothera's unusual hybridization patterns

  • Stress Response Studies:

    • Examination of how CcsA function is affected by environmental stresses

    • Understanding CcsA's role in O. argillicola's adaptation to harsh shale barren environments

    • Investigation of potential stress-responsive regulation of CcsA

  • Development of Improved Expression and Purification Methods:

    • Optimization of heterologous expression systems for O. argillicola CcsA

    • Refinement of purification protocols to obtain larger quantities of functional protein

    • Development of methods to maintain heme in the reduced state during purification

How can engineered variants of CcsA be utilized to understand cytochrome c biogenesis and potentially improve plant stress tolerance?

Engineered variants of CcsA offer several opportunities for basic research and potential applications:

  • Structure-Function Analysis:

    • Creation of point mutations in conserved residues to dissect their specific roles

    • Development of truncated versions to identify minimal functional domains

    • Generation of chimeric proteins combining domains from different species to understand evolutionary adaptations

  • Improved Heme Handling:

    • Engineering variants with enhanced heme binding or protection capabilities

    • Modification of residues to alter heme affinity or redox properties

    • Creation of variants that can utilize alternative metalloporphyrins

  • Plant Stress Tolerance Applications:

    • Development of CcsA variants with improved function under oxidative stress conditions

    • Engineering of variants that maintain cytochrome c biogenesis under temperature extremes

    • Creation of variants that could enhance energy production efficiency under stress

  • Biosensor Development:

    • Utilization of CcsA's heme-binding properties to develop sensors for redox state or heme levels

    • Creation of fusion proteins that report on cellular redox conditions

    • Development of in vivo imaging tools based on CcsA variants

  • Synthetic Biology Applications:

    • Integration of engineered CcsA variants into synthetic electron transport chains

    • Development of minimal cytochrome c biogenesis systems for heterologous hosts

    • Creation of novel redox enzymes based on CcsA's heme-binding capabilities

  • Evolutionary Biology Tools:

    • Generation of CcsA variants that can function with different plastome backgrounds

    • Creation of synthetic nuclear-plastid incompatibilities to study speciation mechanisms

    • Development of plastid transformation tools specific for Oenothera species

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.