Recombinant Oenothera argillicola NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic
Description
Introduction to NAD(P)H-quinone oxidoreductase subunit 4L
NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE) represents an important component of the chloroplast NAD(P)H dehydrogenase complex in Oenothera argillicola, commonly known as the Appalachian evening primrose. This protein is encoded by the ndhE gene located in the chloroplast genome and contributes to the plant's photosynthetic apparatus . The enzyme classification (EC 1.6.5.-) indicates its role in catalyzing oxidation-reduction reactions, specifically transferring electrons from NAD(P)H to quinones and similar electron acceptors . The genus Oenothera has been extensively studied due to its unique genetic features and is considered an excellent model for understanding molecular mechanisms of speciation and chloroplast evolution .
Oenothera argillicola belongs to a genus with five genetically distinct plastomes that have been completely sequenced, providing valuable insights into plant molecular evolution . These studies have revealed the complex genetic architecture of Oenothera species and their adaptation to various ecological niches. The ndhE protein, as part of the NAD(P)H dehydrogenase complex, contributes to cyclic electron flow around photosystem I, which is particularly important under certain environmental stress conditions . This cyclic pathway helps maintain the proper balance of ATP and NADPH required for optimal photosynthetic efficiency and plant growth.
The recombinant form of this protein provides researchers with a valuable tool for studying its structure, function, and interactions within the photosynthetic electron transport chain. By producing the protein in bacterial expression systems, scientists can obtain sufficient quantities for detailed biochemical and structural analyses . The addition of affinity tags, such as the histidine tag (His-tag), facilitates purification and detection in experimental settings, enabling more precise characterization of its properties and functions.
Protein Sequence and Identification
The recombinant Oenothera argillicola NAD(P)H-quinone oxidoreductase subunit 4L protein consists of 101 amino acids with the sequence: MILEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNSVNLNFVTFSDFFDSRQLKGDIFSIFIIAIAAAEAAIGLAIVSSIYRNRKSIRINQSNLLNK . This sequence represents the complete protein from its initial methionine to the terminal lysine residue. The protein is identified in the UniProt database with the accession number B0Z4S7, which serves as a unique identifier for this specific protein across biological databases . The gene encoding this protein, designated as ndhE, is located in the chloroplast genome of Oenothera argillicola, consistent with its function in chloroplast metabolism .
The protein sequence suggests a hydrophobic nature, which is consistent with its role as a membrane-associated protein within the chloroplast thylakoid membrane system. The predominance of hydrophobic amino acids like leucine, isoleucine, and valine indicates membrane-spanning domains that anchor the protein within the lipid bilayer . Charged and polar residues are likely positioned at interfaces with the aqueous environment or involved in interactions with other subunits of the NAD(P)H dehydrogenase complex. The specific arrangement of these amino acids determines the protein's folding pattern and functional properties within the larger enzyme complex.
Sequence analysis and comparison with homologous proteins from other plant species can provide insights into conserved domains and critical functional regions. Such evolutionary conservation typically indicates amino acid residues essential for the protein's structure or catalytic activity . The ndhE protein represents one of several subunits that together form the functional NAD(P)H dehydrogenase complex in chloroplasts, highlighting the modular nature of these large enzyme assemblies. Structural predictions based on the sequence suggest multiple alpha-helical transmembrane domains, which is consistent with its localization and function in the chloroplast membrane system.
Expression Systems and Methods
The recombinant Oenothera argillicola NAD(P)H-quinone oxidoreductase subunit 4L is typically produced in Escherichia coli expression systems, which provide an efficient platform for generating substantial quantities of the protein for research purposes . The bacterial expression utilizes an N-terminal histidine tag (His-tag), which facilitates subsequent purification through affinity chromatography techniques . This approach allows for the isolation of the target protein from the complex mixture of bacterial cellular components with relatively high purity. The expression of chloroplastic proteins in bacterial systems requires careful optimization of growth conditions, induction parameters, and purification protocols to maximize yield and maintain the protein's native properties.
The production process typically involves transforming E. coli cells with an expression vector containing the ndhE gene sequence optimized for bacterial expression . Following transformation, bacterial cultures are grown under controlled conditions until they reach an appropriate density for protein induction. The addition of specific inducers, such as isopropyl β-D-1-thiogalactopyranoside (IPTG) for lac-based promoter systems, triggers the expression of the recombinant protein. After a suitable induction period, cells are harvested, lysed, and the target protein is extracted through various purification techniques.
Despite being a chloroplastic protein native to plant cells, the successful expression of ndhE in bacterial systems demonstrates the versatility of E. coli as a host for heterologous protein production . This approach circumvents the challenges associated with extracting the native protein from plant tissues, which would be complicated by its membrane association and relatively low abundance. The bacterial expression system also allows for potential modifications to enhance solubility, stability, or specific functional properties of the recombinant protein, providing researchers with valuable flexibility for various experimental applications.
Purification and Quality Control
Following expression in E. coli, the His-tagged recombinant ndhE protein undergoes purification processes to isolate it from bacterial cellular components . The primary purification step typically involves immobilized metal affinity chromatography (IMAC), which exploits the high affinity of the His-tag for divalent metal ions such as nickel or cobalt. Additional purification steps may include size exclusion chromatography, ion exchange chromatography, or other techniques to achieve the desired purity level. The final product is typically provided as a lyophilized powder with purity greater than 90% as determined by SDS-PAGE analysis .
Quality control measures are essential to ensure the recombinant protein meets research-grade standards. These assessments typically include verification of protein identity through mass spectrometry, confirmation of size and purity via SDS-PAGE, and validation of structural integrity through various spectroscopic methods . For enzymatically active proteins, functional assays may be performed to confirm that the recombinant product retains its native catalytic properties. These quality control procedures ensure that the purified protein is suitable for its intended research applications.
The recombinant protein is typically supplied with detailed information regarding its concentration, buffer composition, and storage conditions to maintain stability and activity . Depending on the specific research application, additional characterization may include determination of oligomeric state, secondary structure content, or thermal stability. This comprehensive characterization provides researchers with confidence in the quality and consistency of the recombinant protein for their experimental work, facilitating reliable and reproducible results in studies involving this chloroplastic enzyme component.
Enzymatic Activity and Mechanism
The NAD(P)H-quinone oxidoreductase subunit 4L functions as part of the NAD(P)H dehydrogenase complex in chloroplasts, participating in electron transport processes essential for photosynthesis . This enzyme complex catalyzes the oxidation of NAD(P)H and the corresponding reduction of quinones, facilitating electron flow within the chloroplast electron transport chain . The reaction involves the transfer of electrons from the reduced cofactors NADH or NADPH to various quinone substrates, contributing to cyclic electron flow around photosystem I. This process is particularly important under certain environmental conditions, such as high light intensity or drought stress, where it helps balance the ATP/NADPH ratio required for optimal photosynthetic performance.
While the specific catalytic mechanism of the chloroplastic NAD(P)H dehydrogenase complex has not been fully elucidated, insights can be gained from related enzymes such as human NQO1 . In these related enzymes, catalysis proceeds via a substituted enzyme mechanism involving a tightly bound FAD cofactor . The oxidized FAD accepts electrons from NAD(P)H, becoming reduced to FADH₂. The oxidized cofactor (NAD(P)⁺) then leaves the active site, allowing the quinone substrate to enter and receive electrons from FADH₂, completing the catalytic cycle. This two-electron reduction of quinones helps avoid the formation of potentially harmful semiquinone radicals, which can generate reactive oxygen species damaging to cellular components.
Cellular Localization and Physiological Significance
In the broader context of plant physiology, the NAD(P)H dehydrogenase complex contributes to cyclic electron flow around photosystem I, which generates ATP without producing NADPH . This alternative electron pathway becomes particularly important under certain environmental stress conditions when the plant needs to adjust its ATP/NADPH ratio to meet metabolic demands. By facilitating this cyclic electron flow, the complex helps maintain photosynthetic efficiency under variable environmental conditions, contributing to the plant's adaptive capacity and stress tolerance. The presence and conservation of this complex across various plant species underscores its physiological importance in photosynthetic organisms.
The Oenothera genus, including O. argillicola, has been extensively studied for its unique genetic features and distinctive plastome-genome interactions . The genus exhibits an interesting combination of genetic traits that make it particularly valuable for studying molecular mechanisms of speciation and plastid evolution . The characterization of chloroplast proteins like ndhE contributes to our understanding of these complex genetic systems and their evolutionary significance. Research on these proteins helps elucidate the functional implications of plastome variations observed among different Oenothera species, providing insights into the molecular basis of their ecological adaptations and evolutionary divergence.
Evolutionary Significance and Conservation
The evolutionary analysis of the NAD(P)H dehydrogenase complex in plant chloroplasts reveals interesting patterns of conservation and divergence across different species. The Oenothera genus, with its five genetically distinct plastomes, provides a particularly valuable system for studying the evolution of chloroplast-encoded proteins like ndhE . The complete sequencing of these plastomes has enabled detailed comparative analyses, shedding light on the evolutionary relationships among these species and the temporal appearance of various genetic changes . These studies contribute to our understanding of chloroplast genome evolution and the adaptive significance of variations in photosynthetic proteins.
The genus Oenothera is uniquely suited for studying molecular mechanisms of speciation due to its interesting combination of genetic features . The plastome-genome compatibility/incompatibility patterns observed in various Oenothera species provide insights into the molecular basis of reproductive barriers and speciation processes . Proteins like ndhE, encoded by the plastid genome, may play roles in these compatibility relationships, potentially contributing to the reproductive isolation mechanisms that drive speciation events. This evolutionary perspective highlights the broader significance of studying chloroplast proteins beyond their immediate functional roles in photosynthesis.
Comparative studies of NAD(P)H quinone oxidoreductases across different organisms reveal varying degrees of sequence conservation in functionally important regions. While substantial sequence divergence may occur in some portions of the protein, catalytic domains and substrate-binding sites often show higher conservation due to functional constraints . In human NQO1, certain polymorphic variants are associated with increased disease risks, demonstrating how even single amino acid substitutions can significantly impact protein stability and function . Similar principles likely apply to plant ndhE, where specific sequence features have been conserved throughout evolution to maintain its essential role in chloroplast electron transport processes.
Experimental Utilities and Techniques
Recombinant Oenothera argillicola NAD(P)H-quinone oxidoreductase subunit 4L provides researchers with a valuable tool for investigating various aspects of chloroplast function and photosynthetic electron transport. The availability of the purified protein enables detailed biochemical characterization, including analyses of substrate specificity, kinetic parameters, and regulatory mechanisms . Such studies contribute to our understanding of how this protein participates in electron transfer processes within the chloroplast. The recombinant protein can also be used for structural studies, potentially including X-ray crystallography or cryo-electron microscopy, which would provide insights into its three-dimensional organization and interactions with other components of the NAD(P)H dehydrogenase complex.
Immunological applications represent another important use of the recombinant protein, as it can serve as an antigen for generating specific antibodies . These antibodies can then be employed in various techniques such as immunoblotting, immunoprecipitation, or immunolocalization to study the expression, abundance, and subcellular distribution of the native protein in plant tissues. Such immunological approaches are particularly valuable for investigating how environmental conditions or developmental stages affect the expression and regulation of this chloroplastic enzyme component. The recombinant protein may also serve as a standard or positive control in assays designed to detect or quantify the native protein in plant extracts.
Protein-protein interaction studies represent a third major application area for the recombinant ndhE protein. Techniques such as pull-down assays, yeast two-hybrid screens, or cross-linking experiments can identify binding partners and characterize the protein's integration into the larger NAD(P)H dehydrogenase complex . Understanding these interaction networks is crucial for elucidating the assembly, regulation, and function of this multi-protein enzyme complex. The recombinant protein may also be used in reconstitution experiments, where individual components are combined to reconstruct functional complexes in vitro, providing insights into the minimal requirements for enzymatic activity and the specific contributions of each subunit.
Potential Biotechnological Applications
Beyond basic research applications, the study of NAD(P)H-quinone oxidoreductase subunit 4L and the broader NAD(P)H dehydrogenase complex holds potential implications for biotechnological applications in agriculture and energy production. Understanding the structure and function of this protein could inform strategies for enhancing photosynthetic efficiency in crop plants, potentially leading to improved yields or stress tolerance . The manipulation of cyclic electron flow around photosystem I, in which this enzyme complex participates, represents a potential approach for optimizing the ATP/NADPH ratio in photosynthetic tissues to better meet the metabolic demands under various environmental conditions or to support specialized biosynthetic pathways.
The enzymatic properties of NAD(P)H quinone oxidoreductases, including their ability to catalyze the reduction of various quinone substrates, may find applications in bioremediation or detoxification processes . These enzymes can potentially transform certain environmental pollutants or xenobiotics into less harmful forms, contributing to pollution mitigation strategies. The specificity and efficiency of these transformations depend on the structural and catalytic properties of the enzymes, which can be investigated using recombinant proteins like the Oenothera argillicola ndhE. Such applications would require detailed characterization of substrate specificities and reaction conditions to assess the feasibility and efficiency of enzyme-based detoxification approaches.
In the field of synthetic biology, characterized components of natural electron transport chains, including proteins like ndhE, could serve as building blocks for designing artificial electron transport systems with novel functionalities . These engineered systems might be employed in biofuel production, biosensors, or other biotechnological applications requiring controlled electron transfer processes. The modular nature of biological electron transport chains, where distinct protein complexes mediate specific steps in electron flow, provides inspiration for designing synthetic systems with customized electron transfer pathways. Knowledge gained from studying natural components like the NAD(P)H dehydrogenase complex contributes to the foundation needed for such innovative bioengineering approaches.
Current Limitations and Technical Challenges
Despite the availability of recombinant Oenothera argillicola NAD(P)H-quinone oxidoreductase subunit 4L for research purposes, several challenges remain in fully understanding this protein's structure and function. A significant limitation is the lack of a high-resolution three-dimensional structure, which would provide detailed insights into its molecular architecture and functional mechanisms . Obtaining such structural information is complicated by the protein's membrane association and its integration into a larger multiprotein complex, presenting technical challenges for crystallization or other structural determination methods. Future efforts employing advanced structural biology techniques, such as cryo-electron microscopy or integrative structural modeling approaches, may help overcome these limitations.
Another challenge lies in reconstituting the complete NAD(P)H dehydrogenase complex in vitro to study its assembled structure and function. As ndhE represents just one subunit of this complex enzymatic machinery, understanding its role requires considering its interactions with multiple other protein components . Successful reconstitution would require producing and purifying all relevant subunits in their native conformations and establishing conditions that promote proper assembly. This complex undertaking necessitates substantial technical expertise and resources but would provide valuable insights into the functioning of the complete enzyme complex that cannot be obtained by studying individual subunits in isolation.
The physiological regulation of the NAD(P)H dehydrogenase complex in chloroplasts represents another area requiring further investigation. How environmental factors, developmental stages, or metabolic conditions affect the expression, assembly, and activity of this complex remains incompletely understood . Studying these regulatory mechanisms requires integrating various experimental approaches, including transcriptomics, proteomics, and metabolomics, ideally combined with structural and functional analyses. Such comprehensive studies would provide a more complete picture of how this enzyme complex is regulated in response to changing conditions and how it contributes to the plant's adaptive responses to environmental challenges.
Emerging Research Opportunities
Advances in structural biology techniques present exciting opportunities for elucidating the three-dimensional architecture of the NAD(P)H dehydrogenase complex, including the positioning and interactions of the ndhE subunit. Cryo-electron microscopy has revolutionized the structural determination of large protein complexes, potentially offering a viable approach for resolving the structure of this chloroplastic enzyme assembly . Such structural insights would significantly enhance our understanding of how the various subunits cooperate to catalyze electron transfer reactions and how the complex interfaces with other components of the photosynthetic apparatus. This structural information would also provide a foundation for computational approaches, such as molecular dynamics simulations, to explore the dynamic aspects of the complex's function.
The increasing availability of genomic and transcriptomic data from diverse plant species enables comparative evolutionary analyses of the NAD(P)H dehydrogenase complex across the plant kingdom . Such studies can reveal patterns of conservation and divergence in different lineages, potentially correlating with ecological adaptations or photosynthetic strategies. The Oenothera genus, with its well-characterized plastome diversity, provides an excellent model system for such evolutionary investigations . These comparative approaches can identify conserved functional elements as well as lineage-specific adaptations, contributing to our understanding of how this complex has evolved in response to different environmental pressures throughout plant evolutionary history.
Emerging genetic engineering technologies offer new possibilities for investigating the functional significance of the NAD(P)H dehydrogenase complex in plant physiology. CRISPR-Cas9 and related genome editing tools provide unprecedented precision in modifying chloroplast genes, potentially enabling the creation of plants with altered versions of ndhE or other complex components . Such genetically modified plants could serve as valuable experimental systems for assessing the physiological consequences of specific alterations to the complex under various environmental conditions. These functional genomics approaches, combined with detailed biochemical and structural analyses of the recombinant proteins, promise to substantially advance our understanding of how this enzyme complex contributes to photosynthetic efficiency and plant adaptation to environmental challenges.
Product Specs
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Target Background
Q&A
What is the fundamental role of NAD(P)H-quinone oxidoreductase in Oenothera argillicola chloroplasts?
NAD(P)H-quinone oxidoreductase in chloroplasts functions as a key enzyme in photosynthetic electron transport, catalyzing the transfer of electrons from reduced ferredoxin to generate reduction equivalents (NADPH) required for multiple metabolic pathways . In Oenothera species specifically, this enzyme plays a crucial role in maintaining photosynthetic efficiency within the unique genetic context of this genus, which exhibits distinct plastome arrangements . The chloroplastic NAD(P)H-quinone oxidoreductase is particularly important for adapting electron flow under varying light conditions, as the pH of the chloroplast stroma changes depending on light intensity—from neutral to slightly acidic in darkness to alkaline under saturating light conditions .
How does the protein structure of NAD(P)H-quinone oxidoreductase facilitate its function?
The NAD(P)H-quinone oxidoreductase typically exists as a homodimer with two active sites formed at the interface between subunits, meaning both active sites comprise residues from both polypeptide chains . The enzyme contains a tightly bound FAD cofactor essential for its catalytic activity . During catalysis, the NAD(P)H substrate binds in an orientation where the nicotinamide ring aligns parallel to the FAD, enabling efficient electron transfer . The subunit 4L specifically contributes to the structural stability of the enzyme complex and may be involved in membrane association within the chloroplast, similar to how other photosynthetic proteins are anchored to thylakoid membranes through specific protein interactions .
What are the conserved domains in the chloroplastic NAD(P)H-quinone oxidoreductase subunit 4L of Oenothera species?
The chloroplastic NAD(P)H-quinone oxidoreductase subunit 4L contains several conserved domains that are crucial for its function. Based on comparative analysis with related proteins, these likely include FAD-binding domains and NAD(P)H-binding regions . In Oenothera, this protein is encoded by the plastid genome, which has been completely sequenced for several Oenothera species . The plastomes of Oenothera are genetically distinct and contain unique structural arrangements, including inversions that can disrupt known transcriptional linkages, potentially affecting the expression of proteins like NAD(P)H-quinone oxidoreductase . The conservation of these domains across Oenothera species suggests their functional importance despite the genomic rearrangements characteristic of this genus.
What are the optimal conditions for heterologous expression of recombinant Oenothera argillicola NAD(P)H-quinone oxidoreductase subunit 4L?
The expression of recombinant Oenothera argillicola NAD(P)H-quinone oxidoreductase subunit 4L requires careful optimization of several parameters. When designing an expression system, researchers should consider using a vector with a strong promoter coupled with a chloroplast transit peptide if the full protein function is desired. For bacterial expression, E. coli BL21(DE3) or Rosetta strains are recommended to address potential codon bias issues in plant-derived sequences.
Recommended expression parameters include:
| Parameter | Optimal Condition | Notes |
|---|---|---|
| Induction temperature | 18-25°C | Lower temperatures reduce inclusion body formation |
| IPTG concentration | 0.1-0.5 mM | Higher concentrations may not improve yield |
| Induction duration | 16-20 hours | Extended time improves folding of chloroplastic proteins |
| Media supplementation | 0.1 mM FAD | Ensures proper cofactor incorporation |
| Culture density at induction | OD600 = 0.6-0.8 | Balances cell density with metabolic activity |
Expression should be validated by SDS-PAGE and Western blotting using antibodies against either the recombinant tag or conserved epitopes of NAD(P)H-quinone oxidoreductases .
What purification strategy provides the highest yield and activity for the recombinant protein?
A multi-step purification approach is recommended to obtain high-purity recombinant Oenothera argillicola NAD(P)H-quinone oxidoreductase subunit 4L while maintaining its enzymatic activity. The purification strategy should begin with affinity chromatography using an appropriate tag (His-tag or GST-tag), followed by ion exchange chromatography to remove contaminating proteins.
The following purification workflow has demonstrated success with similar oxidoreductases:
-
Initial clarification: Centrifugation of cell lysate at 20,000×g for 30 minutes at 4°C
-
Affinity purification: Ni-NTA or glutathione-sepharose depending on the tag
-
Buffer optimization: 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 10% glycerol, 0.5 mM DTT
-
Additional purification: Size exclusion chromatography to isolate the active dimeric form
Throughout purification, it's crucial to maintain protein stability by including glycerol (10-15%) and reducing agents, as oxidoreductases are sensitive to oxidative damage . Enzyme activity should be monitored at each purification step using standard NAD(P)H oxidation assays to ensure the native conformation is preserved.
How should researchers address solubility challenges with this recombinant protein?
Improving the solubility of recombinant Oenothera argillicola NAD(P)H-quinone oxidoreductase subunit 4L requires addressing several factors that contribute to protein aggregation. When solubility issues arise, researchers should implement the following methodological approaches:
-
Fusion tags optimization: MBP (maltose-binding protein) tags often improve solubility more effectively than His-tags for chloroplastic proteins
-
Co-expression with molecular chaperones: GroEL/GroES or DnaK/DnaJ/GrpE systems can facilitate proper folding
-
Buffer screening: Test multiple buffer compositions varying in pH (6.5-8.5), salt concentration (100-500 mM NaCl), and additives such as glycerol, sucrose, or specific detergents
The addition of FAD during the extraction and purification process is particularly important, as this cofactor stabilizes the protein structure and prevents aggregation . If membrane association is suspected, mild non-ionic detergents (0.05-0.1% Triton X-100 or n-dodecyl-β-D-maltoside) can be included to improve extraction without denaturing the protein structure.
What are the validated methods for measuring NAD(P)H-quinone oxidoreductase activity in vitro?
Several established assay methods can be used to measure the activity of recombinant Oenothera argillicola NAD(P)H-quinone oxidoreductase subunit 4L in vitro. The spectrophotometric approach is most common, monitoring either NAD(P)H oxidation or quinone reduction:
-
NAD(P)H oxidation assay: Measure the decrease in absorbance at 340 nm (ε = 6,220 M⁻¹cm⁻¹) in a reaction mixture containing the enzyme, NAD(P)H, and an appropriate quinone substrate
-
Dichlorophenolindophenol (DCPIP) reduction assay: Monitor the decrease in absorbance at 600 nm as DCPIP is reduced by the enzyme
-
Cytochrome c reduction assay: Measure the increase in absorbance at 550 nm when cytochrome c is used as an electron acceptor
The basic reaction mixture should include:
-
50 mM phosphate buffer (pH 7.4)
-
0.1-0.2 mM NAD(P)H
-
0.05-0.1 mM quinone substrate
-
Recombinant enzyme (5-50 μg/ml)
For accurate kinetic analysis, initial velocity measurements should be performed across a range of substrate concentrations to determine Km and Vmax values . The enzymatic rate should be calculated as the number of substrate molecules converted per unit time, similar to the toothpickase model enzyme system described in educational contexts .
How does pH affect the enzymatic activity and what is the optimal pH range?
The pH significantly influences the activity of NAD(P)H-quinone oxidoreductase enzymes, affecting both substrate binding and catalytic efficiency. For the Oenothera argillicola NAD(P)H-quinone oxidoreductase, pH optimization is particularly important given the evidence that related enzymes exhibit pH-dependent binding characteristics .
Research indicates that the interaction between ferredoxin:NADPH oxidoreductase and its binding partners is strongly increased under acidic conditions, which may be physiologically relevant as the chloroplast stroma pH changes depending on light conditions—from neutral to slightly acidic in darkness to alkaline under saturating light .
To determine the optimal pH for the recombinant enzyme, activity assays should be conducted across a pH range of 5.5-9.0 using appropriate buffer systems:
-
pH a 5.5-6.5: MES buffer
-
pH 6.5-7.5: MOPS or phosphate buffer
-
pH 7.5-9.0: Tris or HEPES buffer
Buffer concentrations should be maintained at 50 mM while ensuring proper ionic strength control. The bell-shaped pH-activity curve typically observed for oxidoreductases reflects the involvement of multiple ionizable groups in catalysis. The pH profile data should be analyzed to determine both the optimal pH for activity and the pKa values of key catalytic residues .
What are the kinetic parameters of the enzyme with different quinone substrates?
The specificity of NAD(P)H-quinone oxidoreductase for different quinone substrates is a critical aspect of its biochemical characterization. Based on studies of related enzymes, the Oenothera argillicola NAD(P)H-quinone oxidoreductase likely exhibits varied kinetic parameters depending on the quinone substrate. A systematic analysis should include natural plastoquinones as well as model substrates.
Typical kinetic parameters for NAD(P)H-quinone oxidoreductases with common substrates include:
| Substrate | Km (μM) | kcat (s⁻¹) | kcat/Km (M⁻¹s⁻¹) |
|---|---|---|---|
| Plastoquinone-1 | 5-15 | 10-30 | 1-6 × 10⁶ |
| Ubiquinone-1 | 10-30 | 8-25 | 0.5-2 × 10⁶ |
| Menadione | 20-50 | 15-40 | 0.5-1 × 10⁶ |
| DCPIP | 30-70 | 20-50 | 0.3-1 × 10⁶ |
These parameters can be determined using standard steady-state kinetic approaches by varying substrate concentrations while maintaining saturating levels of NAD(P)H . For accurate determination of kcat values, the active enzyme concentration should be determined by FAD content analysis rather than total protein concentration.
Inhibition studies using compounds like dicoumarol, which has been shown to be a potent inhibitor of related enzymes with a Ki of approximately 50 pM for rat enzyme and Kd of 120 nM for human enzyme , can provide additional insights into the active site structure and catalytic mechanism.
How does the Oenothera argillicola NAD(P)H-quinone oxidoreductase compare to homologs in other plant species?
The Oenothera argillicola NAD(P)H-quinone oxidoreductase subunit 4L represents an interesting case for comparative genomics and protein evolution studies. Oenothera species possess genetically distinct plastomes that have undergone significant structural rearrangements, including inversions . These genomic changes have potentially influenced the evolution of plastid-encoded proteins like NAD(P)H-quinone oxidoreductase.
When comparing this protein across plant species, researchers should examine:
-
Sequence conservation: Analyze conserved domains versus variable regions to identify functionally critical residues
-
Structural adaptations: Investigate whether Oenothera-specific sequence variations correlate with its ecological niche as a shale-barren endemic species
-
Transcriptional context: Examine how plastome inversions have affected gene organization and potential co-transcription patterns
The inversions found in Oenothera plastomes have disrupted ancestral transcriptional linkages, such as separating accD from rbcL, which in non-rearranged plastid chromosomes are members of a larger gene cluster . This genomic reorganization may have necessitated adaptations in the regulation and possibly the structure of plastid-encoded proteins including NAD(P)H-quinone oxidoreductase components.
What structural features contribute to the substrate specificity of the enzyme?
The substrate specificity of NAD(P)H-quinone oxidoreductase is determined by several structural features that shape the active site architecture. Based on studies of related oxidoreductases, the following structural elements likely influence substrate recognition in the Oenothera argillicola enzyme:
-
FAD-binding domain: The conformation of the bound FAD cofactor creates part of the substrate binding pocket and influences the orientation of incoming quinone substrates
-
Subunit interface residues: As the enzyme functions as a homodimer with active sites at the interface between subunits, the amino acids contributed by both chains collectively shape the substrate binding site
-
Flexible loops near the active site: These regions may undergo conformational changes upon substrate binding, accommodating various quinone structures
Crystallographic studies of related enzymes reveal that inhibitors like dicoumarol bind in a conformation that partially overlaps with the FAD cofactor, explaining their competitive inhibition mechanism with respect to NAD(P)H . Similar structural principles likely apply to the Oenothera enzyme, with specific amino acid variations potentially conferring unique substrate preferences adapted to its native biochemical environment.
How has the unique plastome structure of Oenothera species affected the evolution of this protein?
The evolution of NAD(P)H-quinone oxidoreductase in Oenothera has been shaped by the remarkable plastome rearrangements characteristic of this genus. Oenothera plastomes have undergone significant structural changes, including major inversions that have disrupted ancestral gene arrangements and potentially affected gene expression patterns .
The inversion identified in Oenothera plastomes separates accD from rbcL, disrupting a conserved operon structure found in other plants . This genomic reorganization has several evolutionary implications for plastid-encoded proteins like NAD(P)H-quinone oxidoreductase:
-
Altered transcriptional regulation: The separation of genes from their ancestral operons necessitates new regulatory mechanisms, including potential use of alternative promoters
-
Selective pressure on protein function: Changes in gene expression patterns may have selected for compensatory mutations in the protein sequence to maintain optimal activity levels
-
Co-evolutionary adaptations: Proteins that interact within electron transport chains may have co-evolved to maintain efficient interactions despite changes in expression patterns
The verification of inversion breakpoints in various Oenothera species has shown that these structural changes involve complex molecular mechanisms including tandem repeats and palindrome formation . Understanding how these genomic changes have influenced the evolution of specific proteins provides insight into the remarkable adaptability of the chloroplast genetic system.
What expression systems are most suitable for studying site-directed mutants of the protein?
For studying site-directed mutants of Oenothera argillicola NAD(P)H-quinone oxidoreductase subunit 4L, researchers should select expression systems that balance high protein yield with proper folding and cofactor incorporation. Several systems offer specific advantages for different experimental objectives:
-
Bacterial expression (E. coli):
-
Advantages: Rapid growth, high yield, established protocols
-
Recommended strains: BL21(DE3) pLysS or Rosetta 2 for rare codon usage
-
Modifications: Co-expression with chaperones (GroEL/GroES) improves folding
-
Tags: N-terminal MBP fusion with TEV cleavage site improves solubility
-
-
Yeast expression (Pichia pastoris):
-
Advantages: Eukaryotic folding machinery, high-density cultivation
-
Recommended constructs: Integration into AOX1 locus with α-factor secretion signal
-
Induction conditions: Methanol feed rate optimization is critical for yield
-
-
Plant-based expression (Nicotiana benthamiana):
-
Advantages: Native-like post-translational modifications, chloroplast targeting
-
Method: Agrobacterium-mediated transient expression with chloroplast transit peptide
-
Purification: Requires optimization of extraction from chloroplast membranes
-
For systematic mutagenesis studies, the bacterial system typically offers the best combination of throughput and yield, particularly when coupled with a fluorescent reporter system to monitor proper folding . The Rosetta strain addresses potential codon bias issues that might arise when expressing plant genes in bacteria.
How can researchers effectively study protein-protein interactions involving this enzyme?
Investigating protein-protein interactions of Oenothera argillicola NAD(P)H-quinone oxidoreductase requires a multi-technique approach to capture both stable and transient associations. Based on studies of related proteins, several complementary methods are recommended:
-
In vitro interaction studies:
-
Surface plasmon resonance (SPR): This technique has successfully been used to demonstrate the high affinity of ferredoxin:NADPH oxidoreductase to its binding motifs, with interactions that are strongly increased under acidic conditions
-
Isothermal titration calorimetry (ITC): Provides thermodynamic parameters of binding interactions
-
Pull-down assays: Using tagged recombinant protein to identify interacting partners
-
-
Structural approaches:
-
X-ray crystallography: Has revealed that binding motifs forming polyproline type II helices can induce self-assembly of two monomers into back-to-back dimers in related enzymes
-
Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Identifies regions involved in protein-protein interactions
-
Cross-linking mass spectrometry: Captures transient interactions
-
-
In vivo techniques:
-
Bimolecular fluorescence complementation (BiFC): Visualizes interactions in plant cells
-
Co-immunoprecipitation from chloroplast extracts: Identifies native interaction partners
-
Proximity-dependent biotin identification (BioID): Maps the protein interaction landscape
-
When designing protein interaction experiments, researchers should consider the pH-dependent nature of these interactions, as studies have shown that binding affinity can be strongly increased under acidic conditions , which may reflect physiological regulation mechanisms in the chloroplast where pH changes depending on light conditions.
What are the best approaches for studying the impact of environmental factors on enzyme activity?
Studying how environmental factors affect Oenothera argillicola NAD(P)H-quinone oxidoreductase activity requires both in vitro biochemical assays and in vivo plant-based experiments. A comprehensive approach should address the following environmental variables:
-
Light conditions:
-
Methodology: Compare enzyme activity in plants grown under different light intensities and spectral qualities
-
Measurement: Quantify protein expression levels using immunoblotting and enzyme activity assays
-
Analysis: Correlate changes in activity with chloroplast pH, which shifts from neutral/acidic in darkness to alkaline under saturating light
-
-
Temperature sensitivity:
-
In vitro approach: Measure enzyme kinetics across 5-45°C temperature range
-
In vivo approach: Expose plants to temperature stress regimes and monitor protein expression/activity
-
Correlation: Compare temperature response of the enzyme with the ecological adaptation of Oenothera argillicola to shale barrens
-
-
Oxidative stress:
-
Experimental design: Treat plants with oxidative stress inducers (paraquat, hydrogen peroxide)
-
Analysis: Measure changes in NAD(P)H-quinone oxidoreductase activity and oxidation state
-
Control experiments: Compare with antioxidant enzyme activities (catalase, superoxide dismutase)
-
-
Nutrient availability:
For all environmental studies, researchers should employ RNA-seq or qPCR to monitor transcriptional responses alongside protein-level analyses to distinguish between transcriptional, translational, and post-translational regulatory mechanisms affecting enzyme function under varying environmental conditions.
What role does this enzyme play in stress responses in Oenothera argillicola?
NAD(P)H-quinone oxidoreductase likely plays a significant role in stress responses of Oenothera argillicola, particularly given the plant's adaptation to shale barren environments . The enzyme's function in electron transport and redox homeostasis positions it as a key component in managing oxidative stress under challenging environmental conditions.
When investigating stress response roles, researchers should consider:
-
Drought stress adaptation:
-
Oenothera argillicola's natural habitat in shale barrens suggests adaptation to water-limited conditions
-
The NAD(P)H-quinone oxidoreductase may help maintain photosynthetic efficiency under drought by optimizing electron transport
-
Methods: Compare enzyme activity and expression in plants under controlled drought conditions versus well-watered controls
-
-
High light stress:
-
Related oxidoreductases show pH-dependent binding that may be regulated by light conditions through changes in stromal pH
-
The enzyme likely participates in alternative electron transport pathways that dissipate excess excitation energy
-
Measurement: Chlorophyll fluorescence parameters in wildtype versus plants with altered enzyme expression
-
-
Temperature extremes:
-
Shale barren environments experience significant temperature fluctuations
-
The enzyme may contribute to maintaining photosynthetic capacity across temperature ranges
-
Approach: Measure enzyme thermostability and activity recovery after heat shock treatments
-
-
Oxidative stress management:
-
NAD(P)H-quinone oxidoreductases generally function in reducing free radical load in cells
-
Investigate whether this specific enzyme has evolved enhanced antioxidant capacity in this stress-adapted species
-
Techniques: ROS measurement in chloroplasts under stress conditions with specific inhibitors of the enzyme
-
Understanding the stress response functions of this enzyme could provide insights into the molecular basis of Oenothera argillicola's ecological adaptation as an endemic species with restricted habitat requirements .
How do post-translational modifications affect the enzyme's function and regulation?
Post-translational modifications (PTMs) likely play crucial roles in regulating the activity, stability, and interactions of Oenothera argillicola NAD(P)H-quinone oxidoreductase. Based on knowledge of related enzymes, several PTMs potentially impact its function:
-
Phosphorylation:
-
Likely sites: Serine/threonine residues in regulatory regions
-
Potential effect: Modulation of enzyme activity or membrane association
-
Detection method: Phosphoproteomic analysis combining TiO₂ enrichment with LC-MS/MS
-
Functional validation: Site-directed mutagenesis of phosphorylation sites (Ser/Thr → Ala or Asp)
-
-
Redox-based modifications:
-
Target residues: Accessible cysteine thiols
-
Regulatory mechanism: Reversible oxidation affecting enzyme conformation
-
Analysis approach: Differential alkylation of reduced/oxidized thiols followed by mass spectrometry
-
Physiological relevance: May constitute a feedback mechanism linking enzyme activity to chloroplast redox state
-
-
Membrane-association modifications:
For comprehensive PTM mapping, researchers should combine high-resolution mass spectrometry with specific enrichment techniques for each modification type. Functional studies should then correlate observed modifications with changes in enzyme properties under various physiological conditions, particularly focusing on light-dark transitions which alter chloroplast pH and potentially trigger regulatory PTMs .
What approaches can be used to develop specific inhibitors or activators of this enzyme for research purposes?
Developing specific modulators of Oenothera argillicola NAD(P)H-quinone oxidoreductase activity requires a rational design approach based on structural insights and mechanism-based screening. The following strategic framework is recommended:
-
Structure-based inhibitor design:
-
Starting point: Known inhibitors of related enzymes, such as dicoumarol which acts as a potent competitive inhibitor (Ki = 50 pM for rat enzyme)
-
Approach: Molecular docking studies using homology models of the Oenothera enzyme
-
Rational modifications: Design analogs that exploit unique features of the Oenothera enzyme active site
-
Validation: Isothermal titration calorimetry to determine binding constants
-
-
High-throughput screening approaches:
-
Primary assay: Fluorescent or colorimetric activity assays in 384-well format
-
Compound libraries: Natural product extracts, particularly from plants with evolutionary proximity
-
Hit validation: Dose-response curves and mechanism of inhibition studies
-
Selectivity profiling: Counter-screening against related oxidoreductases
-
-
Photoaffinity labeling for binding site identification:
-
Design: Synthesize photoreactive analogs of identified inhibitors
-
Method: UV-induced crosslinking followed by mass spectrometry analysis
-
Application: Precise mapping of binding sites to guide further inhibitor refinement
-
-
Activator development strategies:
-
Allosteric site identification: Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions
-
Fragment-based screening: Identify small molecules that enhance enzyme activity
-
Physiological relevance: Test activator effects under various pH conditions to mimic chloroplast environmental changes
-
For all modulators, researchers should establish their effects on enzyme kinetics (Km, Vmax, kcat) and determine whether they affect substrate specificity, cofactor binding, or protein-protein interactions. The pH-dependence of modulator binding should be carefully characterized given the importance of pH in regulating related enzymes .
How can researchers address protein instability issues during purification and storage?
Maintaining stability of recombinant Oenothera argillicola NAD(P)H-quinone oxidoreductase during purification and storage presents several challenges that can be systematically addressed through optimized protocols:
-
Cofactor retention strategies:
-
Add FAD (10-100 μM) to all purification buffers
-
Monitor A450/A280 ratio to track cofactor retention
-
For long-term storage, supplement with excess FAD (5-fold molar excess)
-
-
Optimized buffer compositions:
-
Base buffer: 50 mM Tris-HCl or phosphate buffer, pH 7.5-8.0
-
Ionic strength: 150-200 mM NaCl to minimize non-specific interactions
-
Stabilizing additives: 10-15% glycerol, 1 mM DTT or 5 mM β-mercaptoethanol
-
Additional stabilizers: 0.1% Triton X-100 or 0.05% n-dodecyl-β-D-maltoside for membrane-associated forms
-
-
Storage optimization:
-
Temperature: Aliquot and store at -80°C for long-term; avoid repeated freeze-thaw cycles
-
Short-term stability: Can be maintained at 4°C for 1-2 weeks with addition of 0.02% sodium azide
-
Lyophilization: Possible with addition of 5% trehalose as cryoprotectant
-
-
Stability monitoring protocol:
-
Develop and validate a rapid activity assay suitable for routine stability checking
-
Establish thermal shift assays (Thermofluor) to screen stabilizing conditions
-
Track enzyme half-life under various storage conditions
-
The presence of a tightly bound FAD cofactor is particularly critical for maintaining the structural integrity of NAD(P)H-quinone oxidoreductases . Researchers should verify cofactor incorporation during purification by measuring characteristic absorption peaks and ensure saturating concentrations of FAD during storage to prevent cofactor dissociation which often leads to irreversible denaturation.
What strategies help overcome expression challenges for this chloroplastic protein?
Expression of recombinant chloroplastic proteins like Oenothera argillicola NAD(P)H-quinone oxidoreductase subunit 4L often presents unique challenges due to their native membrane association and cofactor requirements. Several strategies can help overcome these obstacles:
-
Expression construct optimization:
-
Remove chloroplast transit peptide for bacterial expression
-
Codon optimization for the expression host (critical for plant-derived sequences)
-
Fusion tags selection: N-terminal MBP tag improves solubility more effectively than His-tag alone
-
Include TEV or PreScission protease sites for tag removal
-
-
Specialized expression protocols:
-
Auto-induction media: Provides gentle, gradual protein induction
-
Cold shock expression: Induce at OD600 = 0.8-1.0, then shift to 15-18°C for 16-24 hours
-
Supplementation: Add 0.1 mM FAD to the culture medium during induction
-
Cell lysis: Gentle lysis using lysozyme treatment followed by mild sonication
-
-
Co-expression strategies:
-
Molecular chaperones: Co-express with GroEL/GroES to improve folding
-
Rare tRNA supplementation: Use Rosetta or CodonPlus strains for plant-derived sequences
-
Partner proteins: Consider co-expressing with natural interaction partners
-
-
Alternative expression systems:
-
Cell-free protein synthesis: Allows direct addition of lipids, cofactors, and folding enhancers
-
Wheat germ extract: Plant-based system more suitable for plant proteins
-
Baculovirus-insect cell system: For cases where bacterial expression fails completely
-
For all expression systems, small-scale pilot experiments should be conducted to optimize conditions before scaling up. Western blotting with antibodies against both the tag and conserved epitopes of NAD(P)H-quinone oxidoreductases can help distinguish between expression issues and folding/stability problems.
How to resolve discrepancies in activity measurements between different assay methods?
Discrepancies in enzyme activity measurements using different assay methods are a common challenge when characterizing NAD(P)H-quinone oxidoreductases. To systematically address and resolve these discrepancies, researchers should:
-
Standardize reaction conditions across assays:
-
Buffer composition: Use identical buffer systems, pH, and ionic strength
-
Temperature control: Ensure precise temperature regulation (±0.5°C) across different instruments
-
Enzyme preparation: Use the same enzyme batch and concentration determination method
-
Substrate quality: Verify purity and stability of NAD(P)H and quinone substrates
-
-
Address method-specific variables:
-
Spectrophotometric assays: Correct for overlapping absorbance spectra of substrates/products
-
Fluorescence-based methods: Account for inner filter effects and potential quenching
-
Oxygen consumption measurements: Ensure consistent oxygen levels in all samples
-
-
Establish conversion factors between methods:
-
Systematic troubleshooting approach:
-
Calculate theoretical rates based on extinction coefficients and quantum yields
-
Test for potential inhibitory contaminants in buffers or substrate preparations
-
Evaluate time-dependent changes in activity (enzyme stability during assay)
-
Consider potential cofactor loss during different assay procedures
-
The methodological differences can be quantified using a standardized comparative approach, similar to how enzyme-substrate interactions are modeled in educational contexts . By systematically varying one parameter at a time while holding others constant, researchers can identify the specific factors responsible for discrepancies between assay methods.
