Recombinant Oenothera argillicola Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Oenothera argillicola Photosystem II CP47 chlorophyll apoprotein (psbB) is a genetically engineered protein critical to the photosynthetic machinery of plants. As part of Photosystem II (PSII), CP47 functions as a core antenna complex that transfers energy from light-harvesting complexes to the PSII reaction center, enabling water splitting and oxygen evolution . The recombinant form is produced in E. coli systems with an N-terminal His tag for purification .

Primary Structure

  • Amino Acid Sequence: The full-length protein comprises 508 residues (UniProt ID: P19819) . Key conserved domains include chlorophyll-binding regions critical for energy transfer .

  • Sequence Homology: Shares >95% identity with CP47 from related Oenothera species (e.g., O. glazioviana and O. parviflora) .

Physical and Chemical Properties

PropertySpecificationSource
Molecular Weight~56 kDa (calculated)
Purity>90% (SDS-PAGE verified)
FormLyophilized powder in Tris/PBS buffer (pH 8.0)
Storage-80°C; avoid repeated freeze-thaw cycles
Reconstitution0.1–1.0 mg/mL in sterile water + 50% glycerol

Functional Role in Photosynthesis

  • Light Harvesting: Binds 14–16 chlorophyll molecules, facilitating energy transfer to the PSII reaction center .

  • Structural Stabilization: Maintains the integrity of the PSII core by linking D1/D2 reaction center proteins .

  • Oxygen Evolution: Indirectly supports water oxidation by stabilizing manganese clusters .

Expression Systems

  • Host: Primarily expressed in E. coli due to cost efficiency and high yield (~1–5 mg/L) .

  • Tags: His-tagged for affinity chromatography .

Research Applications

  • PSII Assembly Studies: Used to investigate protein-protein interactions in PSII biogenesis .

  • Mutagenesis Analysis: Site-directed mutants assess chlorophyll-binding residues’ roles .

  • Antibody Production: Serves as an antigen for generating anti-CP47 antibodies .

Comparative Genomic Insights

  • Plastome Structure: Oenothera argillicola’s chloroplast genome retains conserved PSII genes (psbB, psbD) but shows unique inversions in the trnQ-rbcL region .

  • Intron Loss: Unlike other Oenothera species, O. argillicola retains introns in clpP, suggesting evolutionary divergence in post-transcriptional regulation .

Quality Control and Stability

  • Purity Assurance: Validated via SDS-PAGE and mass spectrometry .

  • Stability Issues: Degrades rapidly if stored above -20°C; glycerol (50%) extends shelf life .

Future Directions

  • Structural Biology: Cryo-EM studies to resolve CP47’s role in PSII supercomplexes .

  • Biotech Applications: Engineering thermostable variants for synthetic photosynthesis .

Product Specs

Form
Lyophilized powder
Note: While we strive to ship the format currently in stock, we understand your specific needs. Please include any format requirements in your order notes, and we will do our best to fulfill them.
Lead Time
Delivery times can vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate this in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your own protocols.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms maintain stability for 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag requirement, please inform us, and we will prioritize fulfilling your request.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Oenothera argillicola (Appalachian evening primrose)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLAVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTVTNPGIWSYEGVAGSHILFSGLCFLAAIWHWVYWDL AIFSDERTGKPSLDLPKIFGIHLFLSGLACFGFGAFHVTGLYGPGIWVSDPYGLTGEVQP VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVGAGLAKNQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDSGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDTQVEFGAFQKLGDPTTRRQAV
Uniprot No.

Target Background

Function
CP47, a chlorophyll apoprotein, is a key component of the photosystem II (PSII) core complex. It binds chlorophyll and plays a crucial role in the primary light-induced photochemical reactions of PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from H2O. This process generates O2 and a proton gradient, which is subsequently used for ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of CP47 chlorophyll apoprotein in Photosystem II?

The CP47 chlorophyll apoprotein is a crucial component of Photosystem II that has been hypothesized to be involved in binding the reaction center chlorophyll. CP47 is encoded by the psbB gene and plays an essential role in the structural organization and function of the photosynthetic apparatus. The protein contains multiple hydrophobic regions that span the thylakoid membrane, creating a specific folding pattern that facilitates chlorophyll binding and energy transfer within the photosystem complex. Studies have identified five pairs of histidine residues in CP47 that are spaced by 13 or 14 amino acids and are located in hydrophobic regions of the protein, suggesting their involvement in chlorophyll binding . The strategic positioning of these histidine residues creates optimal coordination sites for chlorophyll molecules, enabling efficient light harvesting and energy transfer to the reaction center. Experimental evidence has demonstrated that interruption of the psbB gene results in a complete loss of Photosystem II activity, confirming that an intact CP47 is absolutely required for a functional Photosystem II complex .

How conserved is the psbB gene sequence across plant species compared to Oenothera?

The psbB gene demonstrates significant conservation across plant species, reflecting its fundamental role in photosynthesis. Comparative sequence analysis reveals that the psbB gene in cyanobacteria (Synechocystis 6803) shares 68% homology at the DNA level with that of spinach, while the predicted amino acid sequence shows even higher conservation at 76% homology . This pattern of higher protein sequence conservation relative to nucleotide sequence indicates selection pressure operating at the functional protein level rather than at the DNA level. In Oenothera species, the plastid chromosomes exhibit several distinctive characteristics, including a large inversion of approximately 56 kb in the Large Single Copy (LSC) region that occurred in the intergenic regions between accD/rbcL and rps16/trnQ UUG, reversing the gene order between rbcL and trnQ UUG . Despite such structural rearrangements, the hydropathy patterns of CP47 remain remarkably conserved across different species, suggesting that the general CP47 folding pattern in the thylakoid membrane is maintained regardless of the underlying genetic variations . This conservation of protein structure despite genetic divergence underscores the critical functional constraints on the CP47 protein in photosynthetic organisms.

What genomic characteristics make Oenothera species uniquely suited for photosynthesis research?

The flowering plant genus Oenothera possesses a unique combination of genetic features that make it exceptionally valuable for photosynthesis research and the study of molecular mechanisms of speciation. Oenothera species have distinct plastomes (chloroplast genomes) with well-characterized genetic variations that provide natural experimental systems for investigating chloroplast gene function and evolution . The genus exhibits five genetically distinct plastomes that have been completely sequenced, allowing for comparative genomic analyses. A distinctive feature of Oenothera plastid chromosomes is the presence of two copies of the initiator tRNA trnfM CAU, which differ by a single nucleotide polymorphism in plastomes I, II, III, and IV and are part of a tandem repeat structure . Additionally, Oenothera species show unique large-scale genomic rearrangements, such as the approximately 56 kb inversion in the LSC region that affects the organization of photosynthetic genes . These natural variations provide valuable insights into the structural constraints and functional adaptations of photosynthetic proteins like CP47, offering researchers natural mutants to study the effects of sequence and structural variations on photosynthetic efficiency and adaptation to different environmental conditions.

What are the optimal expression systems and conditions for producing recombinant Oenothera argillicola CP47 protein?

Successful production of recombinant Oenothera argillicola CP47 chlorophyll apoprotein requires careful consideration of expression systems and conditions due to the protein's complex membrane-spanning nature and association with chlorophyll molecules. Based on research with similar photosynthetic proteins, bacterial expression systems such as E. coli with specialized vectors containing strong inducible promoters (like T7 or tac) are commonly employed for initial cloning and expression attempts. The psbB gene sequence should be codon-optimized for the chosen expression host to enhance translation efficiency, particularly important for the hydrophobic regions that characterize CP47. Expression conditions must be meticulously controlled, with optimal results typically obtained at lower temperatures (16-18°C) to allow proper folding of this complex membrane protein, alongside reduced inducer concentrations to prevent formation of inclusion bodies . For functional studies requiring properly folded CP47 with bound chlorophyll, more sophisticated eukaryotic expression systems such as green algae (Chlamydomonas reinhardtii) or tobacco chloroplast transformation systems may prove superior, as they provide the native chloroplast environment for correct protein assembly with pigments and cofactors. Purification should utilize mild detergents (n-dodecyl-β-D-maltoside or digitonin) to maintain protein integrity and function, with chromatographic separation techniques optimized for membrane proteins.

How can site-directed mutagenesis of the conserved histidine residues in CP47 inform our understanding of chlorophyll binding and energy transfer?

Site-directed mutagenesis of the conserved histidine residues in CP47 provides a powerful approach to deciphering the molecular mechanisms of chlorophyll binding and energy transfer in Photosystem II. The five pairs of histidine residues spaced by 13 or 14 amino acids in hydrophobic regions of CP47 are prime candidates for chlorophyll binding sites based on their spatial arrangement and biochemical properties . A systematic mutagenesis approach would involve replacing each histidine residue individually with neutral amino acids (like alanine) or alternative metal-coordinating residues (like cysteine) to evaluate their specific contributions to chlorophyll binding. Spectroscopic techniques including absorption spectroscopy, circular dichroism, and time-resolved fluorescence can quantify changes in chlorophyll binding affinity and orientation following each mutation. Changes in energy transfer efficiency can be measured using ultrafast spectroscopy techniques to track excitation energy movement through the mutated complexes. X-ray crystallography or cryo-electron microscopy of purified wild-type and mutant proteins can reveal structural alterations that affect the spatial organization of chlorophyll molecules. These combined approaches would generate a comprehensive structure-function map correlating specific histidine residues with their roles in organizing the chlorophyll network that facilitates efficient light harvesting and energy transfer to the Photosystem II reaction center.

What experimental approaches can resolve the structural interactions between recombinant CP47 and other Photosystem II components?

Understanding the structural interactions between recombinant Oenothera argillicola CP47 and other Photosystem II components requires a multi-faceted experimental approach combining biochemical, biophysical, and structural biology techniques. Co-immunoprecipitation assays using antibodies against CP47 can identify direct protein-protein interactions within the Photosystem II complex, while crosslinking mass spectrometry can map specific amino acid contacts between CP47 and neighboring proteins. Förster Resonance Energy Transfer (FRET) with fluorescently labeled CP47 and partner proteins provides dynamic information about protein proximity and orientation in the membrane environment. Hydrogen-deuterium exchange mass spectrometry can identify regions of CP47 that become protected upon assembly with other Photosystem II components, revealing interaction interfaces . For high-resolution structural analysis, single-particle cryo-electron microscopy of isolated Photosystem II complexes containing recombinant CP47 can visualize the three-dimensional organization of the entire complex, while X-ray crystallography of CP47 in complex with specific partner proteins can resolve atomic-level details of critical interaction sites. Molecular dynamics simulations based on these experimental structures can further elucidate the dynamic aspects of these interactions, including conformational changes that may occur during photosynthetic function. These approaches collectively would generate a comprehensive understanding of how CP47 integrates structurally and functionally within the Photosystem II complex.

What strategies can optimize the genetic manipulation of the psbB gene in Oenothera argillicola?

Optimizing genetic manipulation of the psbB gene in Oenothera argillicola requires specialized techniques that address the unique challenges of chloroplast genome modification. Chloroplast transformation using biolistic particle delivery represents the most efficient approach, with DNA-coated gold particles bombarded into leaf tissue to deliver engineered psbB constructs directly to the chloroplast. The transformation vectors should incorporate homologous flanking sequences derived from the Oenothera argillicola plastome to facilitate targeted homologous recombination into the correct genomic location . Selection markers such as spectinomycin resistance (aadA gene) under the control of chloroplast-specific promoters and terminators enable identification of transformed plants. PCR-based screening using primers that span the integration junctions, such as those developed for Oenothera plastome analysis (e.g., rbcLfor 5′-TGTGGCATATGCCTGCTCTG-3′ and psaI_IVP11rev 5′-GGAGAAATCCATTCTTGTCGTC-3′), can verify correct integration . Successful transformants must undergo multiple rounds of selection to achieve homoplasmy (uniform population of transformed chloroplast genomes), as verified by Southern blot analysis. For transient expression studies, protoplasts isolated from Oenothera leaves can be transformed using polyethylene glycol-mediated DNA uptake, allowing rapid assessment of gene expression and protein localization before undertaking the more laborious stable transformation process. Site-directed mutagenesis of specific histidine residues can be performed using overlap extension PCR before integration into the transformation vectors.

How can researchers effectively analyze the impact of genotypic diversity on CP47 function in Oenothera populations?

Analyzing the impact of genotypic diversity on CP47 function in Oenothera populations requires an integrated ecological, genetic, and biochemical approach. Field experiments should establish plots with controlled genotypic diversity (monocultures versus polycultures) of Oenothera argillicola at various densities, similar to methods used in studies with Oenothera biennis . Microsatellite DNA markers can genotype individual plants to confirm actual diversity levels within experimental plots. Chlorophyll fluorescence measurements using pulse-amplitude modulation (PAM) fluorometry on individual plants across diversity treatments can quantify Photosystem II efficiency parameters including Fv/Fm (maximum quantum yield), ΦPSII (effective quantum yield), and NPQ (non-photochemical quenching). Gas exchange measurements can correlate photosynthetic performance with CP47 variation across genotypes. Leaf samples collected from plants across diversity treatments should undergo RNA extraction for quantitative RT-PCR analysis of psbB expression levels and proteomic analysis to quantify CP47 protein abundance. Biochemical isolation of thylakoid membranes followed by blue-native PAGE can separate intact Photosystem II complexes for comparative structural analysis across genotypes. Statistical approaches such as linear mixed-effects models can analyze how genetic diversity at the population level influences individual CP47 function, while controlling for environmental factors and density effects . This comprehensive approach would reveal how natural genetic variation in psbB across different Oenothera genotypes influences photosynthetic performance at both individual and population levels.

What protocols yield the best results for purification and structural characterization of recombinant CP47 protein?

Purification and structural characterization of recombinant CP47 protein requires specialized protocols that maintain protein integrity while enabling high-resolution analysis. The purification process should begin with isolation of thylakoid membranes using differential centrifugation in buffered solutions containing osmotic stabilizers like sorbitol or sucrose. Membrane solubilization requires careful selection of detergents, with n-dodecyl-β-D-maltoside (DDM) at 1-1.5% typically providing optimal extraction of intact CP47 while preserving its association with chlorophyll molecules. Multi-step chromatographic purification combining ion exchange (DEAE or Q-Sepharose) and size exclusion chromatography is recommended, maintaining detergent concentration above the critical micelle concentration throughout purification . For structural characterization, negative-stain electron microscopy provides initial validation of protein integrity and homogeneity, while single-particle cryo-electron microscopy offers higher resolution structural information of CP47 within the Photosystem II complex. X-ray crystallography requires additional optimization steps including vapor diffusion crystallization trials with varied precipitants, detergents, and lipid additives to obtain diffraction-quality crystals. Spectroscopic techniques including circular dichroism spectroscopy can confirm secondary structure content, while resonance Raman spectroscopy provides detailed information about chlorophyll-protein interactions within the purified complex. Hydrogen-deuterium exchange mass spectrometry can map solvent-accessible regions and identify structural domains involved in protein-protein or protein-chlorophyll interactions, complementing the high-resolution structural data.

How can researchers interpret contradictory results in CP47 mutation studies across different Oenothera species?

Interpreting contradictory results in CP47 mutation studies across different Oenothera species requires systematic consideration of multiple factors that could contribute to experimental variability. First, researchers should analyze the specific genetic backgrounds of the Oenothera species used, as the five distinct plastomes found in Oenothera exhibit different genetic contexts that may influence CP47 function through epistatic interactions with other photosynthetic components . Sequence alignments of the psbB gene and flanking regions across the species studied can identify background genetic differences that might explain functional variations. The experimental conditions used for each study must be carefully compared, including light intensity, temperature, and growth conditions, as these environmental factors can substantially influence the phenotypic expression of CP47 mutations. Quantitative analysis of photosynthetic parameters using standardized methodologies across species can help distinguish genuine biological differences from methodological artifacts. Researchers should evaluate the molecular characterization depth in each study, including verification of mutation incorporation, protein expression levels, and complex assembly status. Statistical meta-analysis approaches can help identify consistent effects across studies while accounting for species-specific variables. Collaborative cross-laboratory validation studies using identical protocols applied to multiple Oenothera species can resolve whether contradictions result from biological differences or methodological inconsistencies. Finally, evolutionary analysis examining rates of sequence divergence in different domains of CP47 can reveal whether contradictory functional effects correlate with regions experiencing different selective pressures across Oenothera lineages .

What statistical approaches are most appropriate for analyzing the relationship between CP47 sequence variation and photosynthetic efficiency?

Statistical analysis of the relationship between CP47 sequence variation and photosynthetic efficiency requires specialized approaches that account for the hierarchical nature of sequence-structure-function relationships. Multiple regression models incorporating specific sequence variations as predictors and photosynthetic parameters as response variables can identify statistically significant associations between particular amino acid substitutions and functional outcomes. Principal Component Analysis (PCA) can reduce the dimensionality of sequence variation data, grouping co-varying positions that may function together in structural or functional modules within CP47. Partial Least Squares (PLS) regression can handle situations where the number of sequence variables exceeds the number of experimental observations, a common situation in comparative studies across Oenothera species. For evolutionary analysis, phylogenetic comparative methods such as Phylogenetic Generalized Least Squares (PGLS) should be employed to account for shared evolutionary history when comparing sequence-function relationships across species . Machine learning approaches including Random Forest algorithms can identify complex, non-linear relationships between sequence features and functional outcomes, particularly useful for identifying epistatic interactions between multiple residues. To account for environmental influences, mixed-effects models incorporating both fixed effects (sequence variations) and random effects (environmental conditions, individual plant variations) provide robust statistical inference. Permutation tests can establish significance thresholds that account for multiple testing when evaluating many potential sequence-function relationships simultaneously. These statistical approaches collectively provide a rigorous framework for connecting genetic variation in the psbB gene to functional consequences in photosynthetic performance.

What emerging technologies could advance our understanding of recombinant CP47 structure and function?

Several emerging technologies hold tremendous promise for advancing our understanding of recombinant Oenothera argillicola CP47 structure and function. Cryo-electron tomography combined with subtomogram averaging can visualize CP47 within the native thylakoid membrane environment, providing insights into its organization within the complete Photosystem II supercomplex under physiologically relevant conditions. Single-molecule fluorescence microscopy techniques such as PALM (Photoactivated Localization Microscopy) and STORM (Stochastic Optical Reconstruction Microscopy) can track the dynamic assembly and disassembly of CP47 within Photosystem II complexes at nanometer resolution. Advanced mass spectrometry approaches including native mass spectrometry and ion mobility-mass spectrometry can analyze intact membrane protein complexes with associated pigments and lipids, providing compositional and structural information about CP47-containing assemblies . Time-resolved serial femtosecond crystallography using X-ray free electron lasers (XFELs) can capture structural snapshots of CP47 during different stages of the photosynthetic process. CRISPR-Cas9 gene editing of the chloroplast genome in Oenothera species could enable precise in vivo modification of the psbB gene to study structure-function relationships in the native context. Computational approaches including AlphaFold2 and RoseTTAFold can predict CP47 structures from different Oenothera species with increasing accuracy, potentially revealing subtle structural differences that influence function. These technologies, used in combination, promise to provide unprecedented insights into how CP47 contributes to photosynthetic efficiency and how its structure-function relationship has evolved across Oenothera species.

How might climate change impact the evolution and function of CP47 in natural Oenothera populations?

Climate change presents multiple environmental stressors that could significantly impact the evolution and function of CP47 in natural Oenothera populations. Rising temperatures may exert selection pressure on temperature-sensitive domains within CP47, potentially favoring variants with enhanced thermostability to maintain photosynthetic efficiency under heat stress. Altered precipitation patterns leading to increased drought frequency could select for CP47 variants that maintain functional integrity under water-limited conditions that affect thylakoid membrane stability. Increased light intensity and UV radiation in some regions may drive selection for CP47 variants with modified chlorophyll binding properties that optimize light harvesting while minimizing photodamage . Field experiments comparing photosynthetic efficiency of different Oenothera genotypes across temperature and moisture gradients can identify adaptive CP47 variants, while genomic scans of natural populations across climate gradients can detect signatures of selection on the psbB gene. Common garden experiments transplanting Oenothera populations between different climatic conditions can reveal plastic responses versus genetic adaptations in CP47 function. The interaction between genotypic diversity and population density becomes particularly relevant under climate stress, as studies with Oenothera biennis have demonstrated that genotypic diversity can buffer against negative fitness consequences of high density . This buffering effect may become increasingly important as climate change alters competitive dynamics within plant communities. Long-term monitoring of natural Oenothera populations combined with periodic resequencing of the psbB gene could track evolutionary responses to ongoing climate change in real-time, providing valuable insights into photosynthetic adaptation under environmental stress.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.