Recombinant Oenothera argillicola Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your desired format in your order notes for personalized fulfillment.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice shipping is required, please notify us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
For specified tag types, please inform us, and we will prioritize development accordingly.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Oenothera argillicola (Appalachian evening primrose)
Target Names
psbA
Target Protein Sequence
MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient that subsequently drives ATP formation. It comprises a core antenna complex responsible for capturing photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Oenothera argillicola Photosystem Q(B) protein and what is its role in photosynthesis?

Oenothera argillicola Photosystem Q(B) protein, also known as psbA, Photosystem II protein D1, or PSII D1 protein, is a critical component of the photosynthetic machinery in the Appalachian evening primrose (Oenothera argillicola). This protein plays an essential role in the electron transport chain of Photosystem II (PSII), specifically functioning as the primary quinone acceptor binding protein. The D1 protein forms the reaction center of PSII along with the D2 protein, where it binds chlorophyll molecules and facilitates the primary photochemical reactions, including water oxidation and electron transfer. The protein contains 344 amino acids and is integral to the thylakoid membrane structure and function .

Why is recombinant expression of photosystem proteins important for research?

Recombinant expression of photosystem proteins provides several advantages for research purposes. First, it allows for controlled production of specific proteins without the need to isolate them from native plant sources, which can be challenging and yield limited quantities. The recombinant approach enables researchers to introduce modifications such as His-tags for easier purification and detection, as seen with the N-terminal His-tagged version of the Oenothera argillicola Photosystem Q(B) protein . Additionally, this method facilitates structural and functional studies by producing sufficient quantities of homogeneous protein samples. Recombinant expression in systems like E. coli also permits site-directed mutagenesis to explore structure-function relationships, which is particularly valuable for understanding the mechanistic details of photosynthetic processes and protein-protein interactions within the photosystem complexes .

What are the typical storage and handling conditions for recombinant Photosystem Q(B) protein?

For optimal preservation of recombinant Photosystem Q(B) protein activity and structure, specific storage and handling protocols should be followed. The lyophilized protein should be stored at -20°C/-80°C upon receipt, with aliquoting recommended for multiple use scenarios to avoid repeated freeze-thaw cycles, which can degrade protein quality . For reconstitution, the protein should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding glycerol to a final concentration of 5-50% (with 50% being the standard recommendation) is advised for long-term storage at -20°C/-80°C . Working aliquots can be stored at 4°C for up to one week, but repeated freezing and thawing should be avoided. When handling the reconstituted protein, brief centrifugation prior to opening the vial is recommended to ensure all contents settle at the bottom. The protein is typically stored in Tris/PBS-based buffer containing 6% trehalose at pH 8.0 to maintain stability .

How can recombinant Photosystem Q(B) protein be incorporated into artificial photosynthetic systems?

Incorporating recombinant Photosystem Q(B) protein into artificial photosynthetic systems requires a multifaceted approach focusing on maintaining protein functionality outside its native environment. Researchers typically begin by ensuring proper folding and stability of the recombinant protein through optimized buffer conditions (such as the Tris/PBS-based buffer with 6% trehalose at pH 8.0) . The incorporation process often involves embedding the protein into artificial lipid bilayers or nanodiscs that mimic the thylakoid membrane environment. For experimental design, it's crucial to first verify protein activity using spectroscopic methods to assess electron transfer capabilities before integration. One methodological approach involves reconstituting the protein with purified cofactors and additional photosystem components to recreate a minimal functional unit. When combining with synthetic light-harvesting components, researchers must carefully consider the spectral overlap between natural chlorophyll absorption and synthetic chromophores. The His-tag present in the recombinant protein (as in the commercially available N-terminal His-tagged version) can be leveraged for oriented attachment to functionalized surfaces or nanoparticles, enhancing control over the spatial arrangement in artificial systems .

What techniques are most effective for analyzing protein-protein interactions between Photosystem Q(B) protein and other photosynthetic complexes?

Analyzing protein-protein interactions between Photosystem Q(B) protein and other photosynthetic complexes requires sophisticated methodological approaches. Blue Native (BN)/SDS-PAGE electrophoresis has proven particularly effective, as demonstrated in studies of thylakoid membrane proteins . This technique allows for the separation of intact protein complexes in their native state during the first dimension, followed by denaturation and separation of individual components in the second dimension. For identifying specific interaction partners, pull-down assays utilizing the His-tag of recombinant Photosystem Q(B) protein can be employed, coupled with mass spectrometry for protein identification . Chemical cross-linking combined with mass spectrometry (XL-MS) provides valuable information on the spatial proximity of interaction sites. For dynamic interactions, fluorescence resonance energy transfer (FRET) using fluorescently labeled proteins can assess interaction kinetics and conformational changes. Researchers should consider that protein complexes like PSII, PSI/PSII, and ATP synthase have been successfully isolated and characterized using these methods, enabling the identification of over 60 proteins associated with photosynthetic complexes, including multiple forms of Photosystem II proteins .

How do environmental stressors affect the structure-function relationship of Photosystem Q(B) protein?

Environmental stressors significantly alter the structure-function relationship of Photosystem Q(B) protein through multiple molecular mechanisms. Research indicates that salt stress significantly decreases levels of PSII protein complexes in thylakoid membranes, directly impacting the functional organization of the photosynthetic apparatus . High light stress, similarly, induces modifications in the protein's environment, affecting its spectroscopic properties and functionality as observed in comparative studies of photosystems from different organisms adapted to high-light conditions . To investigate these relationships, researchers employ a combination of biochemical and biophysical methods. Spectroscopic analysis using TrESP coupling and dipole parameters can reveal changes in pigment-protein interactions under stress conditions . Proteomic analysis using BN/SDS-PAGE electrophoresis followed by mass spectrometry allows quantification of stress-induced alterations in protein complexes . Exogenous compounds like putrescine have been observed to mitigate salt stress effects by remarkably increasing PSII protein complex formation, suggesting potential protective mechanisms that can be exploited in research settings . These methodological approaches provide insights into adaptive responses that can inform both basic research and applications in improving crop resilience.

What are the optimal expression and purification conditions for recombinant Oenothera argillicola Photosystem Q(B) protein?

The optimal expression and purification of recombinant Oenothera argillicola Photosystem Q(B) protein requires specific conditions to maintain structural integrity and functionality. Based on established protocols, E. coli serves as the preferred expression system due to its ability to produce sufficient quantities of the protein while allowing for N-terminal His-tagging to facilitate purification . For expression, BL21(DE3) or similar E. coli strains are typically used with induction conditions optimized at lower temperatures (16-20°C) to enhance proper folding of membrane proteins. After cell lysis, typically performed using French press at high pressure (30,000 psi for three cycles as used in similar photosystem protein preparations), a multi-step purification protocol is recommended . Initial purification utilizes affinity chromatography with Ni-NTA resins to capture the His-tagged protein, followed by size-exclusion chromatography to remove aggregates and impurities. Throughout the purification process, maintaining a stable buffer environment is critical - typically using Tris/PBS-based buffers with pH 8.0 and including stabilizers such as trehalose (6%) . For membrane protein purification, gentle detergents like n-dodecyl-β-D-maltoside should be included in buffers to maintain solubility while preserving native-like folding . The final purified protein should achieve greater than 90% purity as determined by SDS-PAGE analysis .

How can researchers effectively reconstitute Photosystem Q(B) protein into liposomes for functional studies?

Effective reconstitution of Photosystem Q(B) protein into liposomes requires precise methodological steps to maintain protein orientation and functionality. Begin by preparing liposomes using a mixture of phospholipids that mimic the thylakoid membrane composition (typically phosphatidylcholine, phosphatidylglycerol, and sulfoquinovosyldiacylglycerol in appropriate ratios). The dried lipid film should be hydrated in buffer compatible with the protein (similar to the Tris/PBS-based storage buffer at pH 8.0) . After liposome formation through extrusion or sonication to create unilamellar vesicles, solubilized Photosystem Q(B) protein (reconstituted from lyophilized powder at 0.1-1.0 mg/mL) should be gradually incorporated at lipid-to-protein ratios between 50:1 and 200:1, depending on the specific experimental requirements . The protein-detergent-lipid mixture is then subjected to controlled detergent removal, preferably using biobeads or dialysis against detergent-free buffer over 24-48 hours at 4°C. To verify successful reconstitution, researchers should employ a combination of techniques: freeze-fracture electron microscopy to visualize protein incorporation, dynamic light scattering to confirm vesicle size distribution, and fluorescence quenching assays to assess protein orientation within the bilayer. Functional validation can be performed through electron transport measurements using artificial electron donors and acceptors that interact with the Q(B) binding site .

What analytical techniques are most suitable for assessing the purity and integrity of recombinant Photosystem Q(B) protein?

Multiple complementary analytical techniques should be employed to comprehensively assess the purity and integrity of recombinant Photosystem Q(B) protein preparations. SDS-PAGE analysis serves as the primary method for evaluating protein purity, with properly prepared samples showing greater than 90% purity on Coomassie-stained gels . For higher sensitivity, western blotting using antibodies specific to either the His-tag or the Photosystem Q(B) protein can detect contaminants at lower concentrations. Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) provides valuable information on sample homogeneity and potential aggregation states. Circular dichroism spectroscopy should be used to verify proper secondary structure formation, particularly important for this membrane protein with its characteristic alpha-helical regions. Mass spectrometry techniques, particularly MALDI-TOF-MS and LC-ESI-MS/MS as employed in similar photosystem protein analyses, can confirm the molecular weight and sequence coverage of the protein . For functional integrity assessment, binding assays with known quinone substrates and cofactors can verify the proper folding of the Q(B) binding pocket. When working with labeled or reconstituted preparations, absorption spectroscopy in the visible region (400-700 nm) can further confirm proper pigment binding and protein-pigment interactions, essential for the functional integrity of photosynthetic proteins .

How does the amino acid sequence of Oenothera argillicola Photosystem Q(B) protein contribute to its structural stability and function?

The amino acid sequence of Oenothera argillicola Photosystem Q(B) protein (344 amino acids) contains several critical domains that directly contribute to its structural stability and functional properties. Analysis of the sequence reveals a characteristic pattern of hydrophobic transmembrane helices that anchor the protein within the thylakoid membrane, interspersed with hydrophilic loops extending into the stromal and lumenal spaces . The full sequence (MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA) includes conserved histidine and aspartate residues that coordinate the binding of cofactors including chlorophylls, pheophytins, and the plastoquinones QA and QB . The QB binding pocket, which gives the protein its name, is formed by specific amino acid residues that create the precise microenvironment required for quinone binding and electron transfer. Notably, the protein contains regions associated with high susceptibility to photodamage, particularly under stress conditions, which explains its rapid turnover rate in vivo compared to other photosystem components . Structure-function analyses using recombinant proteins have shown that even minor sequence variations in these critical regions can significantly alter electron transfer kinetics and susceptibility to photoinhibition, making this protein a key target for research on photosynthetic efficiency and stress responses .

What spectroscopic techniques provide the most insight into the electronic structure and energy transfer processes involving Photosystem Q(B) protein?

Multiple spectroscopic techniques provide complementary insights into the electronic structure and energy transfer processes involving Photosystem Q(B) protein. Absorption spectroscopy in the visible region (400-700 nm) serves as a foundational technique, revealing the pigment composition and excitonic coupling between chlorophylls, as demonstrated in studies using TrESP coupling and dipole parameters calculation methods . Time-resolved fluorescence spectroscopy with picosecond to nanosecond resolution captures the energy transfer dynamics between antenna pigments and the reaction center where the Q(B) protein functions. For deeper mechanistic understanding, transient absorption spectroscopy can track the electron transfer events from initial excitation through to quinone reduction at the Q(B) binding site with femtosecond resolution. Electron paramagnetic resonance (EPR) spectroscopy proves invaluable for characterizing the formation and properties of radical intermediates during electron transfer reactions. Circular dichroism spectroscopy in both the visible and far-UV regions provides information on pigment-protein interactions and protein secondary structure, respectively. Resonance Raman spectroscopy offers vibrational fingerprints of the cofactors and their protein environment, providing insights into subtle structural changes during function. When applying these techniques to recombinant Photosystem Q(B) protein preparations, researchers should account for potential differences in pigment binding and protein environment compared to native systems, which can be assessed through comparative analysis with wild-type proteins from model organisms such as Synechocystis .

How can molecular dynamics simulations enhance our understanding of Photosystem Q(B) protein conformational changes during electron transport?

Molecular dynamics (MD) simulations provide powerful insights into the conformational dynamics of Photosystem Q(B) protein that are difficult to capture experimentally. To implement this approach effectively, researchers should begin with the known amino acid sequence of Oenothera argillicola Photosystem Q(B) protein (344 residues) to construct an accurate structural model . When building the simulation system, it's crucial to embed the protein within a lipid bilayer composition that mimics the thylakoid membrane environment and include explicit water molecules along with relevant cofactors (chlorophylls, pheophytins, plastoquinones, and metal ions). For studying electron transport mechanisms, researchers can employ hybrid quantum mechanics/molecular mechanics (QM/MM) approaches, with the QB binding site and immediate surroundings treated quantum mechanically while the remainder of the system uses classical force fields. Simulations should include multiple redox states of the system to track conformational changes associated with electron transfer events. Analysis of trajectory data should focus on key metrics including: hydrogen bonding networks around the QB binding site, water accessibility changes during quinone binding/unbinding events, protein backbone fluctuations that may gate electron transfer, and lipid-protein interactions that influence conformational stability. Comparative simulations between wild-type and mutant variants can predict the functional consequences of specific amino acid substitutions, complementing experimental studies. Researchers should validate simulation results against experimental data such as spectroscopic measurements or crystallographic B-factors whenever possible .

What techniques are most effective for studying post-translational modifications of Photosystem Q(B) protein in different species and under varying environmental conditions?

Studying post-translational modifications (PTMs) of Photosystem Q(B) protein across species and environmental conditions requires a sophisticated multi-technique approach. Mass spectrometry-based proteomics forms the cornerstone of PTM analysis, with both top-down and bottom-up approaches providing complementary information. For bottom-up analysis, researchers should employ high-resolution techniques such as nano-LC-MS/MS after tryptic digestion of purified protein, with careful optimization of ionization conditions to detect modifications such as phosphorylation, acetylation, and oxidation . Enrichment strategies specific to each PTM type (such as phosphopeptide enrichment using titanium dioxide) can enhance detection sensitivity for less abundant modifications. For studying environmental responses, researchers should design controlled exposure experiments where organisms are subjected to defined stress conditions (high light, salinity, temperature extremes) before protein isolation, as demonstrated in studies examining salt stress responses in photosynthetic proteins . Comparative proteomic approaches using BN/SDS-PAGE coupled with mass spectrometry enable quantitative assessment of PTM changes across conditions . Site-directed mutagenesis of putative modification sites in recombinant proteins, followed by functional assays, can verify the physiological significance of identified PTMs. Importantly, researchers should implement bioinformatic workflows that incorporate species-specific sequence information to properly map identified PTMs to the correct structural domains, allowing for evolutionary comparisons of modification patterns across species in relation to their environmental adaptations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.