Recombinant Oenothera berteriana Cytochrome c oxidase subunit 2 (COX2)

Shipped with Ice Packs
In Stock

Description

Characteristics of COX2

Oenothera berteriana COX2 is encoded by the mitochondrial genome, but in some plant species, COX2 has been found to be transferred to the nucleus during evolution . The cox2 gene in Oenothera berteriana contains introns, which are non-coding sequences that are removed from the pre-mRNA during splicing . In some vascular plants, the first intron of the cox2 gene undergoes trans-splicing, where the exons are transcribed from separate RNA molecules and then joined together .

Function and Importance

COX2 is a vital component of the cytochrome c oxidase complex, which catalyzes the final step in the electron transport chain . This process involves the transfer of electrons from cytochrome c to oxygen, reducing it to water and generating a proton gradient across the inner mitochondrial membrane . This proton gradient drives the synthesis of ATP, the primary energy currency of the cell, through oxidative phosphorylation .

Evolutionary Aspects

The study of Oenothera berteriana COX2 and its gene structure provides insights into the evolution of plant mitochondrial genomes . The presence of introns, their splicing mechanisms, and the potential transfer of the cox2 gene to the nucleus shed light on the dynamic nature of mitochondrial genomes and the evolutionary processes shaping them .

Mitochondrial Genome Organization in Oenothera

The mitochondrial genome of Oenothera exhibits a complex organization with repetitive sequences that can lead to alternative genome structures through recombination . These repeats are flanked by unique sequence-contigs, creating 'double forks' and various contig-repeat-contig combinations . Analysis of these combinations reveals structural diversity and phylogenetic variation within the mitochondrial genomes of different Oenothera species .

COX2 and Photosynthesis

Studies on mutant plants with deficiencies in the mitochondrial electron transport chain have shown a relationship between mitochondrial function and photosynthesis . For example, reduced photosynthetic efficiency is observed in mutants with impaired complex I activity, suggesting that the mitochondrial electron transport chain plays a role in optimizing photosynthetic performance .

Research Findings

TopicDescription
Intron SplicingThe cox2 gene contains introns that are removed via splicing mechanisms . Some introns may undergo circularization or possess non-encoded polyA tracts, indicating multiple splicing pathways .
Genome StructureThe mitochondrial genome of Oenothera has a complex organization with repetitive sequences leading to various genome structures .
Evolutionary RateMitochondrial genes like cox1 evolve slowly, making them less suitable for phylogenetic studies at lower taxonomic levels .
Photosynthesis InteractionReduced photosynthetic efficiency in mitochondrial mutants suggests a link between mitochondrial function and photosynthesis .
Anti-inflammatory ActivityStudies on endophytic fungi have identified compounds that inhibit COX-2 expression .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the available format, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
COX2; COII; COXII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-258
Protein Length
full length protein
Species
Oenothera berteroana (Bertero's evening primrose)
Target Names
COX2
Target Protein Sequence
MIVNECLFFTIALCDAAEPWQLGFQDAATPMMQGIIDLHHDILFFLILILVFVLWILVRA LWHFYYKKNPIPQRIVHGTTIEILWTIFPSIILMFIAIPSFALLYSMDEVVVDPAMTLKA IGHQWYWTYEYSDYNSSDEQSLTFDSYMIPEDDLELGQLRLLEVDNRVVVPVKTNLRLIV TSADVLHSWAVPSLGVKCDAVPGRLNQISMLVQREGVYYGQCSEICGTNHAFMPIVIEAV SATDYTNWVSNLFIPPTS
Uniprot No.

Target Background

Function

Recombinant Oenothera berteriana Cytochrome c oxidase subunit 2 (COX2) is a component of cytochrome c oxidase (Complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multisubunit complexes: succinate dehydrogenase (Complex II, CII), ubiquinol-cytochrome c oxidoreductase (Complex III, CIII), and cytochrome c oxidase (Complex IV, CIV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred via the CuA center (in subunit 2) and heme a (in subunit 1) to the binuclear center (BNC) in subunit 1. This BNC, composed of heme a3 and CuB, reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Oenothera berteriana Cytochrome c oxidase subunit 2 (COX2)?

Cytochrome c oxidase subunit 2 (COX2) is an essential component of the mitochondrial respiratory chain complex IV. In Oenothera berteriana, COX2 is encoded by the mitochondrial genome and plays a crucial role in cellular respiration. The gene contains intronic regions that undergo splicing before the mature protein is produced. The cox2 gene in plant mitochondria, including Oenothera species, contains introns that exhibit complex splicing mechanisms, as evidenced in studies of cox2 intron 1 that demonstrate both linear forms with non-encoded 3' terminal adenosines and heterogeneous circular forms lacking 3' nucleotide stretches . This dual presence suggests multiple novel group II splicing mechanisms operating simultaneously in plant mitochondria.

How does the mitochondrial genome organization in Oenothera berteriana differ from other plant species?

The mitochondrial genome of Oenothera species, including O. berteriana, exhibits distinctive organizational features compared to other plants. The Oenothera mitochondrial genome contains various repetitive elements that contribute to genome reorganization through recombination. These recombinogenic repeat pairs (RRPs) are classified into three categories based on size: large (825-1625 bp), intermediate (239-479 bp), and small (171-179 bp) . In O. berteriana specifically, studies have identified multiple intermediate-sized repeats (ISRs) and one long-sized repeat (LSR). This complex organization results in multiple alternative configurations of the mitochondrial genome through recombination events, which has significant implications for gene expression and evolution of the mitochondrial genome.

What are the standard methods for isolating mitochondria from Oenothera berteriana for COX2 studies?

Isolating high-quality mitochondria from Oenothera species requires specialized protocols due to the viscous nature of Oenothera tissue homogenates. An effective isolation method involves:

  • Harvesting mature rosette leaves (approximately 100g)

  • Incubating leaves in ice water for 30 minutes

  • Drying using a salad spinner

  • Homogenizing in a modified BoutHomX buffer (0.4 M sucrose, 50 mM Tris, 25 mM boric acid, 10 mM EGTA, 10 mM KH₂PO₄)

  • Purifying through a triple Percoll density gradient (18%, 23%, 50%)

The addition of boric acid and EGTA is particularly important as these compounds effectively liquefy the viscous homogenates from Oenothera leaf tissue. Boric acid reacts with 1,2-dihydroxy groups of polysaccharides, while EGTA specifically chelates Ca²⁺ ions associated with the gelling properties of mucilage . All isolation steps should be performed at 4°C to maintain mitochondrial integrity.

How do recombinogenic repeat pairs (RRPs) in the Oenothera mitochondrial genome influence COX2 gene expression?

The recombinogenic repeat pairs (RRPs) in the Oenothera mitochondrial genome create a complex genomic architecture that can significantly influence gene expression. These repeats participate in recombination events that generate different contig-repeat-contig (CRC) configurations which exist in varying stoichiometries. Analysis of similar scenarios in O. elata has revealed that some CRC configurations can be substantially more abundant than others, with differences in representation ranging from 1% to over 50% of the total population .

For genes like COX2, this genomic plasticity may influence expression in several ways:

  • Positioning of regulatory elements: Recombination can alter the proximity of promoters and enhancers to the COX2 coding region

  • Creation of alternative splice sites: Different genomic arrangements may introduce or remove splicing regulatory elements

  • Transcript stability: Various genomic configurations might yield transcripts with different stabilities

The stoichiometric table below illustrates how different CRC configurations for various repeat regions can vary in abundance:

ConfigurationAbundance in Configuration 1Abundance in Configuration 2Abundance in Configuration 3Abundance in Configuration 4
825 bp repeat1-4%39-49%47-50%3-6%
397 bp repeat1-5%45-47%48-52%0-1%
370 bp repeat0-1%50-52%45-48%0-4%
261 bp repeat47-52%0-1%0-1%48-51%
171 bp repeat0-2%50-52%48%0-1%

These varying configurations can create a heterogeneous population of mitochondrial genomes that may respond differently to cellular signals, potentially fine-tuning COX2 expression under different environmental conditions .

What are the challenges in expressing recombinant Oenothera berteriana COX2 in heterologous systems?

Expressing recombinant Oenothera berteriana COX2 in heterologous systems presents several significant challenges:

  • Intron processing: The cox2 gene contains introns that require specific splicing machinery. Heterologous systems may lack the appropriate splicing factors for correct intron removal. Research on cox2 intron 1 has revealed complex splicing mechanisms, including both hydrolytic splicing followed by polyadenylation and an in vivo circularization pathway .

  • Codon optimization: Plant mitochondrial genes often exhibit distinctive codon usage that differs from bacterial or yeast expression systems, necessitating codon optimization for efficient translation.

  • Post-translational modifications: COX2 undergoes specific post-translational modifications in plant mitochondria that may be absent in heterologous systems.

  • Membrane integration: As a mitochondrial membrane protein, COX2 requires proper membrane insertion machinery, which may differ in heterologous systems.

  • Protein toxicity: Overexpression of membrane proteins like COX2 can often be toxic to host cells, requiring careful regulation of expression levels.

To address these challenges, researchers often employ strategies such as:

  • Using plant-based expression systems like tobacco BY-2 cells

  • Creating synthetic genes with optimized codons and without introns

  • Adding appropriate targeting sequences for correct subcellular localization

  • Incorporating solubility tags to improve protein handling

  • Implementing inducible expression systems to minimize toxicity effects

How does the sequence divergence in Oenothera mitochondrial genes affect structural and functional studies of recombinant COX2?

Sequence divergence in Oenothera mitochondrial genes presents unique challenges for structural and functional studies of recombinant COX2. Although the search results do not specifically address COX2 sequence divergence in Oenothera, they do highlight the exceptional divergence observed in mitochondrial genes of related plant species. For instance, in Viscum, both large and small subunit rRNA genes exhibit significant sequence divergence while maintaining considerable conservation at the secondary structure level .

Applied to COX2 research, this suggests:

  • Primary sequence conservation vs. structural conservation: Despite potential sequence divergence, functional domains of COX2 may maintain structural conservation through compensatory mutations that preserve protein folding and function.

  • Species-specific interactions: Divergent sequences may reflect adaptations for species-specific protein-protein interactions within the respiratory chain complexes.

  • Antigenic differences: Sequence divergence affects epitope presentation, potentially requiring species-specific antibodies for immunodetection.

  • Structure prediction challenges: Standard homology modeling approaches may be less reliable due to sequence divergence, necessitating experimental structure determination.

When designing experiments with recombinant Oenothera COX2, researchers should consider these divergence patterns and potentially include comparative analyses with COX2 from model plant species to identify conserved functional regions versus species-specific adaptations.

What are the optimal heterologous expression systems for producing recombinant Oenothera berteriana COX2?

The selection of an appropriate heterologous expression system for recombinant Oenothera berteriana COX2 depends on experimental objectives and protein applications. Based on current research in plant mitochondrial protein expression, the following systems offer distinct advantages:

  • Bacterial expression systems (E. coli):

    • Advantages: Rapid growth, high yields, simple genetic manipulation

    • Limitations: Lack of post-translational modifications, issues with membrane protein folding

    • Methodology: Use specialized strains (C41/C43) designed for membrane protein expression with mild induction conditions (16°C, 0.1mM IPTG)

  • Yeast expression systems (P. pastoris, S. cerevisiae):

    • Advantages: Eukaryotic processing capabilities, suitable for membrane proteins

    • Limitations: Longer generation time than bacteria, potential glycosylation differences

    • Methodology: Integration of expression constructs into genomic DNA for stable expression

  • Plant-based expression systems:

    • Advantages: Native-like post-translational modifications, optimal codon usage

    • Limitations: Lower yields, longer production time

    • Methodology: Transient expression in Nicotiana benthamiana leaves or stable transformation of suspension cultures

  • Cell-free expression systems:

    • Advantages: Avoids toxicity issues, allows supplementation with lipids or chaperones

    • Limitations: Higher cost, limited scale

    • Methodology: Wheat germ or insect cell extracts supplemented with artificial membrane systems

What techniques can be used to analyze the intron splicing patterns in cox2 gene from Oenothera berteriana?

Analyzing intron splicing patterns in the cox2 gene from Oenothera berteriana requires specialized techniques to capture the diverse splicing intermediates and products. Based on research with similar plant mitochondrial introns, the following methodological approaches are recommended:

  • RT-PCR analysis:

    • Design primers flanking the intron-exon boundaries to detect spliced and unspliced forms

    • Use nested PCR for increased specificity and sensitivity

    • Implement quantitative RT-PCR for measuring relative abundance of different splicing products

  • Circular RT-PCR:

    • Specifically designed to detect circularized intron molecules

    • First-strand cDNA synthesis with a primer annealing to the 3' end of the intron

    • PCR amplification with divergent primers to capture circular molecules

    • This technique has successfully identified heterogeneous circular introns in cox2 that lack 3' nucleotide stretches

  • RNase H analysis:

    • Used to distinguish between linear and circular RNA species

    • Treatment of RNA with RNase H in the presence of DNA oligonucleotides complementary to specific regions

    • Analysis of the resulting fragments by Northern blotting

    • This approach has provided supporting evidence for the presence of both linear and circular excised intron species in plant mitochondria

  • Northern blot analysis with intron-specific probes:

    • Allows size determination of various splicing intermediates

    • Can detect multiple forms including full-length linear introns with non-encoded 3' terminal adenosines

  • High-throughput sequencing approaches:

    • RNA-seq with specialized library preparation to capture both linear and circular RNA species

    • Long-read sequencing (PacBio, Nanopore) to identify full-length splicing variants

    • Small RNA sequencing to detect potential intron-derived small RNAs

Each technique has specific strengths in detecting particular aspects of cox2 intron splicing. A comprehensive analysis would employ multiple complementary approaches to fully characterize the complex splicing patterns that may include both hydrolytic splicing followed by polyadenylation as well as in vivo circularization pathways .

How can mitochondrial genomic analysis methods be applied to study COX2 gene evolution in Oenothera species?

Studying COX2 gene evolution in Oenothera species requires comprehensive mitochondrial genomic analysis approaches that account for the complex structure and dynamic nature of plant mitochondrial genomes. The following methodological strategy integrates multiple techniques:

  • Graph-based genome assembly:

    • Implement specialized assembly algorithms designed for repeat-rich plant mitochondrial genomes

    • Use a combination of short and long-read sequencing data

    • Apply methods similar to those used for other Oenothera species, which successfully resolved complex genomic structures

  • Identification of recombinogenic repeat pairs (RRPs):

    • Analyze simplified genome graphs to identify repeat regions

    • Classify repeats into size categories using k-means clustering

    • Determine repeat distributions across Oenothera species to identify conserved and species-specific elements

  • Stoichiometric analysis of genomic configurations:

    • Map high-throughput sequencing reads to all possible contig-repeat-contig (CRC) configurations

    • Calculate relative abundance of each configuration

    • Implement custom data processing pipelines to overcome the peculiarities of different sequencing datasets

  • Comparative genomic analysis:

    • Align COX2 gene sequences from multiple Oenothera species

    • Identify conserved coding and regulatory regions

    • Analyze species-specific features that may indicate adaptive evolution

  • Experimental validation:

    • Use PCR to confirm predicted genomic arrangements

    • Implement Southern blotting to verify recombination events affecting the COX2 gene region

    • Apply long-range PCR to capture large genomic contexts

The table below summarizes the characteristics of repeat elements that could potentially influence COX2 gene evolution in Oenothera species:

SpeciesNumber of RRPsLong-size repeats (825-1625 bp)Intermediate-size repeats (239-479 bp)Small-size repeats (171-179 bp)
O. villaricae7151
O. biennis6150
O. elata5131

These repeat elements can facilitate genomic rearrangements through recombination, potentially affecting COX2 gene structure, regulation, and evolution across Oenothera species .

What are the best approaches for assessing the functional integrity of recombinant Oenothera berteriana COX2?

Assessing the functional integrity of recombinant Oenothera berteriana COX2 requires multiple complementary approaches that evaluate its structural properties, assembly into complex IV, and enzymatic activity. The following analytical techniques provide a comprehensive assessment framework:

  • Spectroscopic analysis:

    • UV-visible spectroscopy to monitor characteristic absorption peaks of heme groups

    • Circular dichroism (CD) spectroscopy to assess secondary structure integrity

    • Fluorescence spectroscopy to evaluate conformational changes upon substrate binding

  • Cytochrome c oxidase activity assays:

    • Oxygen consumption measurements using oxygen electrodes

    • Spectrophotometric assays monitoring the oxidation of reduced cytochrome c

    • Polarographic methods to determine electron transfer rates

  • Protein complex assembly analysis:

    • Blue native polyacrylamide gel electrophoresis (BN-PAGE) to assess incorporation into complex IV

    • Co-immunoprecipitation with antibodies against other complex IV subunits

    • Size exclusion chromatography to determine complex formation

  • Structural integrity assessment:

    • Limited proteolysis to evaluate proper folding

    • Thermal shift assays to determine stability

    • Hydrogen-deuterium exchange mass spectrometry to examine conformational dynamics

  • Functional reconstitution:

    • Incorporation into liposomes or nanodiscs for activity measurements in a membrane-like environment

    • Complementation assays in COX2-deficient systems

    • Electron microscopy to visualize properly assembled complexes

For comparative analysis, it is advisable to perform parallel assessments with native COX2 isolated from Oenothera mitochondria and recombinant COX2 from well-characterized model plants. This multi-faceted approach provides a comprehensive evaluation of whether the recombinant protein maintains the structural and functional characteristics necessary for its biological role in the respiratory chain.

How can computational approaches help predict the impact of sequence variations on Oenothera berteriana COX2 function?

Computational approaches offer powerful tools for predicting how sequence variations in Oenothera berteriana COX2 might impact protein function without requiring extensive laboratory experimentation. A comprehensive computational strategy includes:

When analyzing evolutionary patterns, researchers should be mindful of the conservation patterns observed in other mitochondrial genes, such as rRNA genes, which can maintain significant secondary structure conservation despite primary sequence divergence . This principle might also apply to COX2, where functionally critical structural elements may be maintained through compensatory mutations despite sequence variations.

What techniques are most effective for analyzing post-translational modifications of recombinant Oenothera berteriana COX2?

Post-translational modifications (PTMs) of COX2 are critical for its proper function within the cytochrome c oxidase complex. Analyzing these modifications in recombinant Oenothera berteriana COX2 requires specialized techniques that offer high sensitivity and specificity. The following methodological approaches provide comprehensive PTM characterization:

  • Mass spectrometry-based approaches:

    • Liquid chromatography-tandem mass spectrometry (LC-MS/MS) for global PTM mapping

    • Multiple reaction monitoring (MRM) for targeted quantification of specific modifications

    • Electron transfer dissociation (ETD) and electron capture dissociation (ECD) for preserving labile modifications

    • Top-down proteomics to analyze intact protein with all modifications preserved

  • Site-specific modification analysis:

    • Phosphorylation: Phospho-specific antibodies, Phos-tag SDS-PAGE, titanium dioxide enrichment

    • Oxidative modifications: Derivatization methods (DNPH for carbonyls), redox proteomics approaches

    • Metal coordination: X-ray absorption spectroscopy, electron paramagnetic resonance spectroscopy

    • N-terminal processing: Edman degradation, specialized N-terminal proteomics

  • Functional impact assessment:

    • Site-directed mutagenesis to create modification-mimicking or modification-preventing variants

    • Activity assays comparing wild-type and mutant proteins

    • Structural analysis to determine how modifications affect protein conformation

  • Temporal dynamics of modifications:

    • Pulse-chase experiments combined with immunoprecipitation

    • Time-resolved proteomics to track modification changes

    • In vitro modification systems to reconstitute modification pathways

  • Comparative PTM profiling:

    • Analysis of modifications in native versus recombinant protein

    • Cross-species comparison to identify conserved modification patterns

    • Examination of modifications under different environmental conditions

A comprehensive PTM analysis workflow should include appropriate controls, such as analyzing COX2 from multiple expression systems to distinguish genuine plant-specific modifications from system-induced artifacts. Additionally, researchers should be aware that the complex splicing mechanisms observed in plant mitochondrial introns, including those found in cox2 , might influence the protein sequence and subsequent modification patterns in ways that are not immediately obvious from genomic sequence analysis alone.

What are the key considerations for future research on recombinant Oenothera berteriana COX2?

Future research on recombinant Oenothera berteriana COX2 should address several key areas to advance our understanding of this protein's structure, function, and evolution. Researchers should consider:

  • Integration of multi-omics approaches: Combining genomics, transcriptomics, proteomics, and metabolomics data to provide a comprehensive view of COX2 function within the cellular context.

  • Investigation of species-specific adaptations: Exploring how unique features of Oenothera berteriana COX2 may represent adaptations to specific environmental conditions or metabolic requirements.

  • Development of optimized expression systems: Creating tailored expression platforms that account for the complex splicing patterns observed in plant mitochondrial genes and provide appropriate post-translational processing.

  • Exploration of the functional significance of genomic recombination: Investigating how the dynamic mitochondrial genome structure in Oenothera species influences COX2 expression and function under different conditions.

  • Application of cutting-edge structural biology techniques: Employing cryo-electron microscopy and other advanced methods to determine the structure of Oenothera berteriana COX2 within the context of the complete cytochrome c oxidase complex.

  • Investigation of protein-protein interactions: Identifying species-specific interaction partners that might explain unique functional properties of Oenothera berteriana COX2.

  • Development of genetic manipulation systems: Establishing efficient transformation protocols for Oenothera species to enable in vivo studies of COX2 function.

By addressing these considerations, researchers will gain deeper insights into the unique biology of Oenothera berteriana COX2 and potentially discover novel principles of mitochondrial gene expression and function that could have broader implications for plant biology and biotechnology.

How does understanding Oenothera berteriana COX2 contribute to broader knowledge in plant mitochondrial biology?

Understanding Oenothera berteriana COX2 contributes significantly to broader knowledge in plant mitochondrial biology in several key ways:

  • Model for complex mitochondrial genome dynamics: The Oenothera mitochondrial genome, with its diverse repetitive elements and recombination patterns , provides an excellent model for studying how genome structure influences gene expression and evolution in plant mitochondria.

  • Insights into RNA processing mechanisms: The complex intron splicing mechanisms observed in plant mitochondrial genes, including cox2 , highlight the diversity of RNA processing pathways that have evolved in plant organelles.

  • Evolutionary adaptation of respiratory complexes: Comparative studies of COX2 across Oenothera species can reveal how respiratory chain components adapt to different environmental conditions and metabolic demands.

  • Nuclear-mitochondrial coordination: Research on recombinant expression of mitochondrially-encoded proteins like COX2 illuminates the intricate coordination between nuclear and mitochondrial genomes in ensuring proper respiratory function.

  • Plant-specific post-translational regulation: Investigation of COX2 modifications can uncover plant-specific regulatory mechanisms that might be applicable to other mitochondrial proteins.

  • Methodological advances in organellar biology: The specialized techniques developed for Oenothera mitochondrial isolation and analysis can benefit research on other challenging plant systems.

  • Evolutionary insights from divergent sequences: The patterns of sequence conservation and divergence in Oenothera mitochondrial genes, similar to those observed in related species , provide valuable data for understanding the constraints on mitochondrial gene evolution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.