Recombinant Oenothera berteriana Cytochrome c oxidase subunit 3 (COX3)

Shipped with Ice Packs
In Stock

Description

Functional Role in Cytochrome c Oxidase

COX3 is one of three core subunits (COX1–3) of cytochrome c oxidase, which facilitates electron transfer from cytochrome c to molecular oxygen. Key functional insights:

  • Structural Contribution: COX3 stabilizes the interaction between COX1 and COX2, maintaining the integrity of the heme a3a_3-CuB_B binuclear center .

  • Evolutionary Conservation: Mitochondrial genes encoding COX3 in Oenothera share homologous promoter regions with COX1, suggesting coordinated transcriptional regulation .

  • Unique Codon Usage: Unlike humans, Oenothera COX3 avoids TGA stop codons and uses CGG for tryptophan, reflecting plant-specific mitochondrial genetic code variations .

Experimental Use

  • SDS-PAGE Analysis: Primary application for protein purity assessment .

  • Mitochondrial Gene Studies: Used to investigate RNA editing, mRNA termini mapping, and homologous recombination in plant mitochondria .

  • Comparative Genomics: Serves as a reference for studying gene rearrangement and intron evolution in angiosperms .

Limitations

  • Not for Human Use: Marked explicitly due to potential endotoxin contamination from E. coli expression .

  • Storage Sensitivity: Requires storage at -20°C/-80°C; repeated freeze-thaw cycles degrade functionality .

Comparative Analysis with Other Species

FeatureOenothera berteriana COX3Human MT-CO3 (P00414)
Gene LocationMitochondrial genomeMitochondrial genome
IntronsAbsentAbsent
mRNA Processing5’-termini shared with COX1 Independently transcribed
Pathway AssociationOxidative phosphorylationLinked to Leber’s optic neuropathy

Key Research Findings

  1. Promoter Shared with COX1: A 657-bp homologous sequence upstream of COX3 and COX1 genes in Oenothera mitochondria acts as a dual promoter, enabling coordinated expression .

  2. Evolutionary Divergence: COX3 in Oenothera lacks introns, unlike fungal homologs, but shares structural motifs with liverwort (Marchantia) and maize COX3 .

  3. Horizontal Gene Transfer (HGT): While COX3 itself is vertically inherited, related mitochondrial genes in parasitic plants (e.g., Viscum) show HGT from Ericales, highlighting complex evolutionary trajectories .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its implementation.
Synonyms
COX3; COXIII; Cytochrome c oxidase subunit 3; Cytochrome c oxidase polypeptide III
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Oenothera berteroana (Bertero's evening primrose)
Target Names
COX3
Target Protein Sequence
MIESQRHSYHLVDPSPWPISGSLGALATTVGGVMYMHPFQGGATLLSLGLIFLLYTMFVW WRDVLRESTLEGHHTKVVQLGLRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWP PKGIGVLDPWEIPFLNTPILLSSGAAVTWAHHAILAGKEKRAVYALVATVSLAIVFTGFQ GMEYYQAPPTISDSIYGSTFYLATGFHGFHVIIGTLFSIICGIRQYLGHLTKEHHVGFEA AAWYWHFVDVVRLFLFVSIYWWGGI
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 3 (COX3) is a component of cytochrome c oxidase, the terminal enzyme in the mitochondrial electron transport chain responsible for driving oxidative phosphorylation. The respiratory chain comprises three multisubunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes work together to transfer electrons from NADH and succinate to molecular oxygen, creating an electrochemical gradient across the inner mitochondrial membrane that drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase is the component that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred through the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Oenothera berteriana Cytochrome c oxidase subunit 3 and what is its significance in research?

Oenothera berteriana Cytochrome c oxidase subunit 3 (COX3) is a mitochondrial protein from Bertero's evening primrose. It functions as a component of the cytochrome c oxidase complex, which is critical for cellular respiration. COX3 has become significant in research due to its unique characteristics in mitochondrial genetics, RNA editing patterns, and evolutionary biology. The protein's full-length sequence consists of 265 amino acids and has been extensively studied for understanding mitochondrial genome organization and expression in plants . Researchers commonly use this protein to investigate mitochondrial RNA processing, protein complex assembly, and evolutionary relationships among plant species.

How should recombinant Oenothera berteriana COX3 be stored and reconstituted for experimental use?

For optimal stability and activity, recombinant Oenothera berteriana COX3 protein should be stored at -20°C to -80°C upon receipt, with aliquoting necessary for multiple use to avoid repeated freeze-thaw cycles that can compromise protein integrity. Before opening, vials should be briefly centrifuged to bring contents to the bottom .

For reconstitution, the recommended protocol is:

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation)

  • Create working aliquots for experimental use

  • Store working aliquots at 4°C for no more than one week

Repeated freeze-thaw cycles should be strictly avoided as they can lead to protein degradation and loss of activity, potentially compromising experimental results.

How does RNA editing affect the expression and function of COX3 in Oenothera species compared to other plants?

RNA editing is a critical post-transcriptional modification in plant mitochondria that alters the nucleotide sequence of RNA molecules, typically through C-to-U conversions. In Oenothera species, particularly O. elata, researchers have identified 681 RNA editing sites, with 511 occurring within genes. Of these, 472 are non-synonymous changes that alter the amino acid sequence, including 3 sites that have gained pre-mature stop codons .

The cox3 gene specifically has been investigated across various plant species for RNA editing patterns. Unlike some plant lineages that show length variations in cox3 sequences, Oenothera and other species ranging from algae to seed plants maintain consistent length in the upstream cox3 region . RNA editing in cox3 appears to be evolutionarily significant, with some editing events being conserved across distant plant lineages.

Comparative analyses show that RNA editing patterns in COX3 vary significantly between plant species:

  • Liverwort species like Pellia show 12 editing sites, three of which are silent

  • Hornworts display both conventional C→U edits and reverse exchanges

  • Club moss (Lycopodium) has only a single editing site in this cox3 region

  • Isoetes shows an extraordinarily high frequency of RNA editing (39% of cytidine residues)

These differences suggest that RNA editing in COX3 evolved independently in different plant lineages and serves to correct genomically encoded sequences to conserved amino acid sequences required for proper protein function.

What methodological approaches are most effective for studying the structure-function relationship of recombinant Oenothera berteriana COX3?

For comprehensive structure-function analysis of recombinant Oenothera berteriana COX3, researchers should implement a multi-faceted approach:

  • Protein Expression and Purification Optimization:

    • Express the protein with various fusion tags (His, GST, MBP) to compare solubility and activity

    • Test expression in different E. coli strains optimized for membrane protein expression

    • Implement detergent screening to identify optimal conditions for solubilization while maintaining native-like structure

  • Structural Analysis:

    • Employ circular dichroism (CD) spectroscopy to assess secondary structure elements

    • Use Cryo-EM for higher-resolution structural determination, especially since COX3 is a membrane protein

    • Implement hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify dynamic regions and potential interaction interfaces

  • Functional Characterization:

    • Develop in vitro reconstitution systems with other subunits of the cytochrome c oxidase complex

    • Measure electron transport activity using oxygen consumption assays

    • Assess proton pumping capability through pH-sensitive fluorescent probes

  • Mutagenesis Studies:

    • Create site-directed mutants at positions subjected to RNA editing in vivo to compare pre-edited and post-edited protein forms

    • Generate systematic alanine scanning mutants to identify functionally critical residues

    • Introduce mutations at evolutionarily conserved positions to determine their impact on assembly and function

These methodologies should be combined with computational approaches, including molecular dynamics simulations and evolutionary conservation analysis, to develop a comprehensive understanding of COX3 structure-function relationships.

How do the mitochondrial genome organization and repeat elements in Oenothera species influence COX3 expression and evolution?

Mitochondrial genome organization in Oenothera species exhibits unique features that potentially influence COX3 expression and evolution. Analysis of three Oenothera species (O. villaricae, O. biennis, and O. elata) reveals complex mitochondrial genome structures with varying numbers of recombinogenic repeat pairs (RRPs) .

The presence of these repeat elements creates a dynamic mitochondrial genome in Oenothera, potentially affecting gene expression through several mechanisms:

  • Genomic Rearrangements: The three Oenothera species harbor different numbers of repeat pairs (O. villaricae: 6, O. biennis: 7, O. elata: 5), which can mediate recombination events leading to genomic rearrangements . These rearrangements may alter gene context and promoter regions, affecting COX3 expression.

  • Master and Sub-circle Formation: Long-size repeats (825-1625 bp) facilitate frequent and reversible recombination events that generate master circles and smaller sub-circles . This dynamic structure may create variations in gene copy number and expression levels.

  • Break-Induced Replication: Intermediate-size repeats (239-479 bp), of which three are shared among all Oenothera species, participate in break-induced replication pathways that increase mitochondrial DNA complexity .

Repeat typeO. villaricaeLength [bp]O. biennisLength [bp]O. elataLength [bp]gene
LSRberS_1211337suavG_43811316johSt_13481352atp9
LSR--suavG_1521625---
ISRberS_443475suavG_1116479johSt_3550825nad6
ISRberS_795239suavG_2311239---
ISRberS_518432-----
ISRberS_539421suavG_1464397johSt_12875397-

This complex genomic organization likely influences COX3 expression through altered transcriptional regulation, RNA processing, and evolutionary trajectories compared to other plant species with different mitochondrial genome structures .

What are the optimal conditions for expressing and purifying recombinant Oenothera berteriana COX3 protein?

Optimal expression and purification of recombinant Oenothera berteriana COX3 requires careful consideration of multiple factors:

Expression System Optimization:

  • Host Selection: While E. coli is commonly used , consider BL21(DE3) pLysS or C41/C43(DE3) strains specifically designed for membrane protein expression

  • Fusion Tags: The N-terminal His-tag approach has proven successful , but alternatives like MBP (maltose-binding protein) can enhance solubility

  • Expression Conditions:

    • Induce expression at lower temperatures (16-20°C)

    • Use lower IPTG concentrations (0.1-0.5 mM)

    • Extended expression time (16-24 hours)

    • Consider auto-induction media for gradual protein production

Purification Protocol:

  • Cell Lysis: Use gentle methods such as enzymatic lysis or French press rather than sonication

  • Solubilization: Include 0.5-1% mild detergents (DDM, LDAO, or digitonin) in lysis buffer

  • IMAC Purification: Use immobilized metal affinity chromatography with imidazole gradient elution

  • Size Exclusion Chromatography: As a polishing step to remove aggregates and contaminating proteins

  • Quality Control: Assess purity by SDS-PAGE (aiming for >90% purity) and verify protein identity by Western blot or mass spectrometry

Buffer Conditions:

  • Purification buffer: 50 mM Tris-HCl pH 8.0, 150-300 mM NaCl, 5% glycerol, appropriate detergent

  • Final storage buffer: Tris/PBS-based buffer with 6% Trehalose at pH 8.0

  • Consider including reducing agents like DTT or 2-mercaptoethanol (0.5-1 mM) to prevent oxidation

By carefully optimizing these conditions, researchers can achieve higher yields of functional recombinant COX3 protein for subsequent experimental applications.

How can researchers effectively analyze RNA editing patterns in COX3 transcripts from Oenothera species?

Analyzing RNA editing patterns in COX3 transcripts from Oenothera species requires a systematic approach combining molecular techniques and bioinformatics:

Experimental Methods:

  • RNA Isolation and cDNA Synthesis:

    • Extract total RNA from mitochondria-enriched fractions using triple Percoll sucrose gradient purification

    • Treat RNA with DNase to remove DNA contamination

    • Synthesize cDNA using reverse transcriptase with oligo(dT) or random hexamer primers

    • Include controls without reverse transcriptase to detect DNA contamination

  • Sequencing Approaches:

    • Direct Sequencing: Amplify COX3 cDNA and genomic DNA using identical primer pairs and compare sequences

    • Cloning and Sequencing: Clone PCR products into vectors and sequence multiple clones to detect heterogeneity

    • RNA-Seq: Perform transcriptome sequencing with rRNA depletion to achieve high coverage of mitochondrial transcripts

    • Nanopore Direct RNA Sequencing: For detecting RNA modifications directly on native RNA molecules

  • Site-Specific Analysis:

    • Poison primer extension to detect editing at specific sites

    • High-resolution melting analysis (HRM) to detect editing-induced changes in melting profiles

    • SNaPshot assays for quantitative measurement of editing efficiency

Bioinformatics Analysis:

  • Alignment and Editing Site Identification:

    • Align genomic DNA and cDNA sequences to identify C-to-U conversions

    • Use specialized tools like PREPACT, REDO, or REDItools2 for RNA editing detection

  • Quantification of Editing Efficiency:

    • Calculate editing efficiency as the percentage of edited reads at each site

    • Compare editing patterns across different developmental stages or environmental conditions

  • Prediction and Classification:

    • Predict the effect of editing on protein structure and function

    • Classify editing sites as synonymous or non-synonymous

    • Identify sites that introduce or remove premature stop codons

Based on previous findings, researchers should expect to identify multiple editing sites in Oenothera COX3 transcripts, with both synonymous and non-synonymous changes. For example, in O. elata, 681 RNA editing sites have been identified, with 511 occurring on genes, 472 being non-synonymous, and 39 being synonymous .

What quality control measures should be implemented when working with recombinant Oenothera berteriana COX3?

Implementing rigorous quality control measures is crucial when working with recombinant Oenothera berteriana COX3 to ensure experimental reproducibility and reliable results:

Protein Identity and Integrity:

  • Sequence Verification:

    • Confirm the DNA sequence of the expression construct before protein production

    • Verify the protein sequence by mass spectrometry (MS/MS) analysis to confirm amino acid sequence matches the expected sequence

  • Protein Purity Assessment:

    • SDS-PAGE analysis with Coomassie staining (target: >90% purity)

    • Silver staining for detection of minor contaminants

    • Western blot using anti-His antibodies or COX3-specific antibodies

    • Size exclusion chromatography to assess homogeneity

  • Structural Integrity:

    • Circular dichroism (CD) spectroscopy to verify secondary structure

    • Thermal shift assays to assess protein stability

    • Limited proteolysis to detect properly folded domains

Functional Validation:

  • Activity Assays:

    • Oxygen consumption measurements if incorporated into functional complexes

    • Cytochrome c oxidation assays

    • Spectroscopic analysis of heme binding properties

  • Interaction Studies:

    • Co-immunoprecipitation with other cytochrome c oxidase subunits

    • Surface plasmon resonance (SPR) or bio-layer interferometry (BLI) to measure binding kinetics

    • Native-PAGE or blue native-PAGE to analyze complex formation

Storage and Stability:

  • Stability Monitoring:

    • Regular SDS-PAGE analysis of stored samples to detect degradation

    • Activity measurements over time to assess functional stability

    • Avoid repeated freeze-thaw cycles (create single-use aliquots)

  • Contamination Testing:

    • Regular testing for microbial contamination

    • Endotoxin testing for experiments involving cell culture or in vivo applications

    • Test for proteolytic activity that might degrade the protein during storage

Documentation:

  • Maintain detailed records of expression conditions, purification methods, and batch variability

  • Assign unique batch numbers and record date of preparation

  • Document all quality control tests performed and their results

Following these quality control measures will ensure that experiments using recombinant Oenothera berteriana COX3 protein are conducted with properly characterized material, enhancing reproducibility and reliability of research outcomes.

How can recombinant Oenothera berteriana COX3 be used to study mitochondrial evolution in plants?

Recombinant Oenothera berteriana COX3 serves as a valuable tool for investigating mitochondrial evolution in plants through several research approaches:

Comparative Evolutionary Studies:

  • Sequence Conservation Analysis:

    • Compare the amino acid sequence of Oenothera berteriana COX3 with orthologs from other plant species

    • Identify conserved domains and residues that have remained unchanged throughout evolution

    • Map these conserved regions onto structural models to identify functionally critical sites

  • RNA Editing Pattern Comparison:

    • Use recombinant COX3 proteins representing pre-edited and post-edited versions to assess functional differences

    • Compare the RNA editing patterns in cox3 across plant lineages, from bryophytes to angiosperms

    • Investigate the evolutionary origins of RNA editing mechanisms, which appeared to have evolved in the tracheophyte line of land plants

  • Structural Biology Approaches:

    • Determine structure-function relationships through mutagenesis of the recombinant protein

    • Compare with other COX3 proteins to understand structural adaptations across species

Experimental Applications:

  • Functional Complementation Studies:

    • Express recombinant Oenothera berteriana COX3 in mitochondrial mutants of other species

    • Assess the ability of the protein to restore respiratory function in heterologous systems

    • Identify species-specific functional constraints

  • Protein-Protein Interaction Networks:

    • Use recombinant COX3 as bait in pull-down assays to identify interacting partners

    • Compare interaction profiles across species to track the evolution of mitochondrial protein complexes

    • Investigate how RNA editing affects these interaction networks

  • Adaptive Evolution Analysis:

    • Investigate the effects of mutations at sites under positive selection

    • Study the functional consequences of RNA editing on protein activity and stability

    • Examine the role of mitochondrial genomic rearrangements in COX3 evolution

The unique genomic organization of Oenothera mitochondria—featuring various repeat elements and recombination events —makes this genus particularly valuable for evolutionary studies. The presence of species-specific long-size repeats and shared intermediate-size repeats across Oenothera species provides insights into the mechanisms driving mitochondrial genome evolution and its effects on genes like cox3 .

What experimental approaches can be used to investigate the role of COX3 in mitochondrial respiratory complexes?

Investigating the role of COX3 in mitochondrial respiratory complexes requires multi-disciplinary approaches that combine biochemical, biophysical, and genetic techniques:

Complex Assembly Studies:

  • In vitro Reconstitution:

    • Combine purified recombinant COX3 with other cytochrome c oxidase subunits

    • Monitor complex assembly using blue native PAGE

    • Assess the impact of specific mutations on assembly efficiency

    • Use site-directed mutagenesis to identify residues critical for subunit interactions

  • Cryo-EM and Structural Analysis:

    • Determine high-resolution structures of assembled complexes containing COX3

    • Compare structures with and without COX3 to understand its structural contribution

    • Map interaction interfaces between COX3 and other subunits

  • Cross-linking Mass Spectrometry:

    • Use chemical cross-linkers to capture transient interactions

    • Identify cross-linked peptides by mass spectrometry

    • Generate spatial restraints for molecular modeling of complex assembly

Functional Characterization:

  • Electron Transfer Activity:

    • Measure oxygen consumption rates in reconstituted systems

    • Compare activities of complexes containing wild-type vs. mutant COX3

    • Assess the effects of RNA editing on electron transfer efficiency

  • Proton Pumping Assays:

    • Use pH-sensitive fluorescent probes to monitor proton translocation

    • Assess COX3's contribution to maintaining the proton gradient

    • Investigate how mutations in predicted proton channels affect proton pumping

  • Reactive Oxygen Species (ROS) Measurements:

    • Determine if COX3 variants affect ROS production

    • Measure superoxide and hydrogen peroxide generation

    • Correlate structural features with ROS production

Advanced Imaging Techniques:

  • Super-resolution Microscopy:

    • Visualize the distribution and organization of respiratory complexes

    • Track complex assembly in real-time using fluorescently tagged components

    • Compare wild-type and COX3-deficient systems

  • Single-Particle Tracking:

    • Monitor the dynamics of individual complexes containing fluorescently labeled COX3

    • Assess mobility, clustering, and interactions with other respiratory complexes

    • Determine how RNA editing affects these dynamics

These experimental approaches will provide comprehensive insights into COX3's structural and functional roles within mitochondrial respiratory complexes, enhancing our understanding of mitochondrial bioenergetics and the consequences of RNA editing on respiratory function.

How can researchers investigate the interplay between RNA editing and protein function in Oenothera berteriana COX3?

Investigating the interplay between RNA editing and protein function in Oenothera berteriana COX3 requires a systematic approach combining molecular biology, biochemistry, and bioinformatics:

Comparative Protein Analysis:

  • Expression of Pre-edited and Post-edited Variants:

    • Generate recombinant proteins representing genomically encoded (pre-edited) and mature (post-edited) COX3

    • Express both variants in E. coli under identical conditions

    • Perform detailed comparative analyses of protein properties

  • Structural Comparison:

    • Use circular dichroism spectroscopy to compare secondary structure elements

    • Employ limited proteolysis to detect structural differences

    • Apply hydrogen-deuterium exchange mass spectrometry to identify regions with altered dynamics

  • Functional Assessment:

    • Compare enzyme kinetics between pre-edited and post-edited proteins

    • Measure thermal stability using differential scanning fluorimetry

    • Assess membrane integration efficiency and topology

Site-Specific Editing Analysis:

  • Targeted Mutagenesis:

    • Create a library of mutants representing each RNA editing site

    • Generate combinations of edited sites to identify synergistic effects

    • Focus particularly on non-synonymous editing sites (472 such sites were identified in O. elata)

  • Computational Prediction:

    • Use molecular dynamics simulations to predict the effects of each editing event

    • Perform in silico analysis of protein stability and folding

    • Model the impact on protein-protein interactions within the respiratory complex

  • Functional Consequences:

    • Investigate how editing affects protein half-life and turnover

    • Assess assembly efficiency into respiratory complexes

    • Measure electron transfer rates and oxygen consumption

Regulatory Mechanisms:

  • Editing Efficiency Analysis:

    • Quantify editing efficiency across different developmental stages

    • Assess the impact of environmental stressors on editing patterns

    • Investigate tissue-specific variations in editing efficiency

  • Identification of Editing Factors:

    • Use protein-RNA crosslinking to identify proteins interacting with cox3 transcripts

    • Perform pull-down assays with pre-edited and post-edited RNA sequences

    • Characterize the RNA recognition elements required for site-specific editing

  • Evolutionary Conservation:

    • Compare editing patterns across Oenothera species and other plant lineages

    • Identify conserved editing sites that likely serve critical functions

    • Investigate the evolutionary forces driving the maintenance of RNA editing

This comprehensive approach will elucidate the functional significance of RNA editing in COX3, providing insights into how this post-transcriptional mechanism contributes to mitochondrial function and plant adaptation.

What are the current knowledge gaps and future research directions for Oenothera berteriana COX3?

Despite significant advances in our understanding of Oenothera berteriana COX3, several knowledge gaps remain that present opportunities for future research:

Structural Characterization:

  • High-resolution structures of Oenothera berteriana COX3 in isolation and within the complete cytochrome c oxidase complex remain undetermined

  • The precise effects of RNA editing on protein structural dynamics have not been fully characterized

  • The molecular mechanisms by which specific amino acid changes affect protein function require further investigation

Functional Aspects:

  • The contribution of COX3 to proton pumping and electron transfer in plant mitochondria needs more detailed characterization

  • The physiological significance of species-specific variations in COX3 sequence and editing patterns remains unclear

  • The role of COX3 in supercomplexes and respiratory chain organization requires further study

Evolutionary Considerations:

  • The evolutionary forces driving the maintenance of RNA editing in plant mitochondria, particularly in COX3, are not fully understood

  • The relationship between mitochondrial genome organization, featuring various repeat elements , and COX3 evolution needs further exploration

  • Comparative analyses across more plant species could reveal evolutionary patterns and functional adaptations

Future Research Directions:

  • Advanced Structural Biology:

    • Apply cryo-electron microscopy to determine high-resolution structures of Oenothera berteriana cytochrome c oxidase containing COX3

    • Use hydrogen-deuterium exchange mass spectrometry to map conformational changes induced by RNA editing

    • Employ single-molecule FRET to investigate dynamic structural changes during enzyme function

  • Systems Biology Approaches:

    • Integrate transcriptomics, proteomics, and metabolomics to understand the systemic effects of COX3 variants

    • Develop computational models of respiratory chain function incorporating COX3's role

    • Investigate network-level consequences of altered COX3 function

  • Synthetic Biology Applications:

    • Engineer synthetic variants of COX3 with enhanced properties

    • Develop chimeric proteins to investigate domain-specific functions

    • Use directed evolution to identify adaptive mutations for specific environmental conditions

  • Environmental Adaptation Studies:

    • Investigate how COX3 variants and editing patterns respond to environmental stressors

    • Assess the role of COX3 in plant adaptation to changing environments

    • Explore potential applications in crop improvement for stress tolerance

These future research directions will not only advance our understanding of Oenothera berteriana COX3 but also contribute broadly to plant mitochondrial biology, evolutionary biology, and potential biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.