Recombinant Oenothera berteriana NADH-ubiquinone oxidoreductase chain 3 (ND3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ND3; NAD3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Oenothera berteroana (Bertero's evening primrose)
Target Names
ND3
Target Protein Sequence
MLEFAPICISLVISLLLSLILLVVPFLFSSNSSTYPEKLSAYECGFDPFGDARSRFDIRF YLVSILFIIFDLEVTFFFPWAVSFNKIDLFGFWSMMAFLLILTIGFLYEWKRGALDWE
Uniprot No.

Target Background

Function

Recombinant Oenothera berteriana NADH-ubiquinone oxidoreductase chain 3 (ND3) is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is considered part of the minimal assembly required for catalytic activity. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor.

Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of NADH-ubiquinone oxidoreductase chain 3 (ND3) in Oenothera berteriana?

NADH-ubiquinone oxidoreductase chain 3 (ND3) is a core subunit of mitochondrial respiratory chain Complex I. In Oenothera berteriana, this protein functions in the transfer of electrons from NADH to ubiquinone in the respiratory chain. The ND3 gene encodes a highly hydrophobic polypeptide that is essential for the catalytic activity of complex I, contributing to the membrane arm of the complex's characteristic L-shaped structure . The protein contains transmembrane domains that anchor it within the inner mitochondrial membrane, serving as part of the proton translocation machinery essential for oxidative phosphorylation.

What distinguishes the mitochondrial DNA of Oenothera berteriana from other plant species?

The mitochondrial DNA of Oenothera berteriana exhibits several unique characteristics compared to other higher plants:

  • Unusually high guanosine + cytosine (G+C) content of 51%

  • Buoyant density in CsCl of 1.710 grams/cubic centimeter

  • Melting point of 90°C

  • Distinct size class of molecules with a length of 100 kilobases

These properties, particularly the high G+C content, are uncommon in plant mitochondrial DNA and represent a distinctive feature of Oenothera berteriana . Additionally, restriction analysis using various endonucleases produced fragments totaling 180-190 kilobases, suggesting intermolecular heterogeneity, which is also observed in other higher plants but with different patterns .

How has the ND3 gene evolved across different plant lineages?

The ND3 gene shows variable genomic locations across plant lineages. While it is typically encoded in the mitochondrial genome of vascular plants, fungi, and animals, interesting exceptions exist. In the "reinhardtii" clade of green algae (including Chlamydomonas reinhardtii, Chlamydomonas eugametos, and Polytomella parva), the ND3 gene has been transferred to the nuclear genome .

This evolutionary transfer required significant modifications to facilitate nuclear expression and mitochondrial import of the protein, including:

  • Acquisition of traits typical of nuclear genes

  • Reduced hydrophobicity compared to mitochondrion-encoded counterparts

  • Addition of mitochondrial targeting sequences

  • Adaptation to nuclear genetic code and codon usage patterns

What are the most effective methods for isolating and purifying mitochondrial DNA from Oenothera berteriana?

Based on established protocols for Oenothera berteriana mitochondrial DNA isolation, the following methodology is recommended:

  • Tissue preparation: Use tissue culture cells of Oenothera berteriana as starting material

  • Extraction process: Implement a differential centrifugation approach to isolate intact mitochondria

  • DNA purification: Extract mtDNA using a gentle lysis procedure to maintain molecular integrity

  • Quality assessment: Characterize the isolated mtDNA by determining:

    • Buoyant density in CsCl (should be approximately 1.710 g/cm³)

    • Melting point (approximately 90°C)

    • Contour length via electron microscopy

  • Structural analysis: Perform restriction fragment analysis using multiple enzymes:

    • Restriction endonuclease I from Serratia marcescens

    • Restriction endonuclease III from Haemophilus influenzae

    • Restriction endonuclease I from Bacillus amyloliquefaciens H

    • Restriction endonuclease I from Escherichia coli

Note: The lengthy purification procedure may compromise circular DNA integrity, resulting in few molecules retaining their circularity. Therefore, rapid processing and gentle handling are essential.

What techniques are most suitable for analyzing RNA editing in the ND3 gene of Oenothera berteriana?

RNA editing is a significant post-transcriptional modification in plant mitochondrial genes. For analyzing RNA editing in the ND3 gene of Oenothera berteriana, the following approaches are recommended:

  • cDNA-SSCP (Single-Strand Conformation Polymorphism) Analysis:

    • Isolate total RNA from plant tissue

    • Treat with DNase I to remove DNA contamination

    • Perform reverse transcription using gene-specific primers

    • Amplify cDNA fragments via PCR

    • Clone individual cDNA fragments

    • Analyze each clone by SSCP to identify editing patterns

    • Sequence representative clones from each pattern to confirm editing sites

  • Direct RT-PCR and Sequencing:

    • Compare genomic DNA and cDNA sequences to identify C-to-U editing sites

    • Use multiple independent clones to assess editing efficiency

In Oenothera berteriana, as in other plants like Helianthus annuus, Petunia hybrida, and Magnolia soulangeana, the ND3 gene contains 25-35 RNA editing sites, which is significantly more than the 3 sites found in radish .

How can recombinant Oenothera berteriana ND3 protein be effectively expressed in heterologous systems?

For successful heterologous expression of recombinant Oenothera berteriana ND3 protein:

  • Vector selection and optimization:

    • Use expression vectors with strong promoters suitable for hydrophobic proteins

    • Optimize codon usage for the host organism

    • Consider fusion tags to enhance solubility (His, GST, or MBP tags)

  • Expression system selection:

    • For functional studies: Mitochondrial targeting in yeast systems

    • For structural studies: E. coli with membrane protein expression optimizations

    • For complex formation studies: Insect cell or mammalian cell systems

  • Protein extraction and purification:

    • Use mild detergents (DDM, LMNG) for membrane protein solubilization

    • Implement two-step purification using affinity chromatography followed by size exclusion

  • Functionality assessment:

    • Reconstitution into liposomes or nanodiscs

    • NADH:ubiquinone oxidoreductase activity assays

    • Electron transport chain complex assembly analysis

  • Storage optimization:

    • Store in Tris-based buffer with 50% glycerol at -20°C

    • For extended storage, maintain at -80°C

    • Avoid repeated freeze-thaw cycles

What role does ND3 play in the assembly and stability of mitochondrial Complex I?

ND3 plays a crucial role in the assembly and stability of mitochondrial Complex I, as demonstrated through knockout and interference studies in model organisms:

  • Complex assembly: The absence of ND3 prevents the assembly of the complete 950-kDa Complex I structure, indicating its essential role in the complex formation pathway .

  • Membrane arm integrity: As a core hydrophobic subunit, ND3 contributes to the structural stability of the membrane domain of Complex I.

  • Assembly pathway position: Research suggests ND3 is incorporated into Complex I during the intermediate stages of assembly, serving as a critical connection point between peripheral and membrane arms.

  • Catalytic function: ND3 is essential for the catalytic activity of Complex I, with its absence completely abolishing NADH:ubiquinone oxidoreductase activity .

  • Conformational changes: The protein likely participates in the conformational changes that couple electron transfer to proton pumping across the inner mitochondrial membrane.

These functions highlight why ND3 is conserved across species and why its absence leads to complete dysfunction of Complex I rather than merely reduced efficiency.

How do RNA editing patterns in the ND3 gene affect protein function in Oenothera berteriana?

RNA editing in the ND3 gene of Oenothera berteriana significantly impacts the resulting protein's structure and function:

  • Codon alterations: C-to-U editing events alter codons to specify different amino acids than those encoded by the genomic DNA, often converting hydrophilic residues (encoded by genomic DNA) to hydrophobic residues (in the mature mRNA).

  • Conservation patterns: Comparative analysis shows that Oenothera berteriana contains between 25-35 RNA editing sites in the nad3/rps12 region, which is considerably more than some species (like radish with 3 sites) but comparable to other plants like Helianthus annuus and Petunia hybrida .

  • Functional consequences:

    • Increased hydrophobicity essential for membrane insertion

    • Creation of start and stop codons

    • Restoration of conserved amino acids important for protein function

    • Enhancement of protein stability within the membrane environment

  • Editing efficiency: The efficiency of editing at different sites varies, creating a population of protein variants that may have subtle functional differences, potentially serving as a regulatory mechanism in response to environmental conditions.

The extensive editing in Oenothera berteriana's ND3 gene suggests an important evolutionary adaptation that fine-tunes protein function beyond what is directly encoded in the mitochondrial genome.

How does horizontal gene transfer affect the evolution of the ND3 gene in plant species including Oenothera?

Horizontal gene transfer (HGT) represents a significant evolutionary mechanism affecting mitochondrial genes in plants, including the ND3 gene:

  • Transfer patterns: Plant mitochondrial genomes frequently experience HGT events, particularly involving parasitic plants as either donors or recipients. This direct contact between parasitic plants and their hosts facilitates genetic exchange .

  • Documented cases: While specific HGT events involving the ND3 gene in Oenothera berteriana have not been directly documented in the provided search results, other genes like atp1, atp6, and matR have been transferred from parasitic plants (e.g., Cuscuta species) to other plant genera .

  • Evolutionary consequences:

    • Introduction of novel genetic material

    • Potential functional advantages through acquisition of adapted gene variants

    • Creation of chimeric genes with unique properties

    • Expansion of genetic diversity beyond vertical inheritance

  • Detection methods: Identifying HGT events requires:

    • Detailed phylogenetic analyses showing incongruent gene trees compared to species trees

    • Identification of anomalous sequence positions in phylogenetic reconstructions

    • Analysis of nucleotide composition and codon usage patterns

    • Evaluation of flanking sequences for signs of insertion

These processes contribute to the complex evolutionary history of mitochondrial genes in plants and may partially explain the distinctive characteristics of Oenothera berteriana's mitochondrial genome.

What can be learned from comparing the nuclear-encoded ND3 in some species versus mitochondrially-encoded ND3 in Oenothera berteriana?

Comparing nuclear-encoded ND3 genes (as found in Chlamydomonas reinhardtii) with mitochondrially-encoded ND3 (as in Oenothera berteriana) reveals significant adaptations:

  • Sequence modifications:

    FeatureNuclear-encoded ND3Mitochondrially-encoded ND3
    HydrophobicityReducedHigher
    Targeting sequencesPresentAbsent
    Codon usageNuclear preferenceMitochondrial preference
    GC contentHigher (in most species)Variable (51% in O. berteriana)
  • Expression characteristics:

    • Nuclear-encoded ND3 requires:

      • Transcription by nuclear machinery

      • Addition of 5' cap and 3' poly(A) tail

      • Export from nucleus

      • Translation in cytoplasm

      • Import into mitochondria

    • Mitochondrially-encoded ND3:

      • Transcription by mitochondrial machinery

      • Co-transcription with adjacent genes

      • RNA editing in plants

      • Translation within mitochondria

  • Evolutionary adaptation signatures:
    Nuclear-encoded ND3 genes show clear evidence of adaptation to nuclear expression systems while maintaining the functional domains necessary for Complex I assembly and function .

  • Regulatory differences:
    Nuclear-encoded genes are subject to nuclear regulatory mechanisms, potentially allowing for more sophisticated transcriptional control compared to the simpler mitochondrial gene expression system.

This comparative analysis provides insights into the evolutionary plasticity of mitochondrial genes and the molecular mechanisms that facilitate gene transfer between organelles.

How can RNA interference (RNAi) be optimally designed to study ND3 function in Oenothera berteriana?

For effective RNAi-based studies of ND3 function in Oenothera berteriana, researchers should implement the following optimized methodology:

  • Target sequence selection:

    • Identify unique regions within the ND3 mRNA sequence

    • Design 21-25 nucleotide siRNA targets with 30-50% GC content

    • Avoid regions with RNA editing sites to ensure consistent targeting

    • Screen potential targets for off-target effects using bioinformatic tools

  • Construct design:

    • Create hairpin structures with sense and antisense sequences

    • Include appropriate spacer regions (e.g., introns) to enhance effectiveness

    • Clone into a vector with a strong promoter compatible with plant expression systems

    • Consider using an inducible promoter system for temporal control

  • Delivery methods:

    • Agrobacterium-mediated transformation for stable integration

    • Particle bombardment for transient expression studies

    • Protoplast transformation for rapid preliminary assessments

  • Validation approaches:

    • RT-qPCR to quantify knockdown efficiency

    • Western blotting to verify protein reduction

    • Complex I activity assays to assess functional consequences

    • Analysis of mitochondrial membrane potential and ATP production

Drawing from successful RNAi studies of ND subunits in other organisms, researchers should anticipate potential compensation mechanisms and design appropriate controls to interpret results accurately .

What methodologies can be employed to study the interaction between ND3 and other Complex I subunits in Oenothera berteriana?

To investigate interactions between ND3 and other Complex I subunits in Oenothera berteriana, researchers can employ several complementary approaches:

  • Crosslinking mass spectrometry (XL-MS):

    • Chemical crosslinking of intact Complex I

    • Digestion and analysis of crosslinked peptides

    • Identification of proximity relationships between subunits

    • Construction of interaction maps based on crosslink distances

  • Blue Native PAGE coupled with Western blotting:

    • Separation of intact respiratory complexes and assembly intermediates

    • Immunodetection using antibodies against ND3 and other subunits

    • Identification of subcomplexes containing ND3

    • Analysis of assembly pathways through comparison of different conditions

  • Co-immunoprecipitation studies:

    • Generation of tagged ND3 constructs or specific antibodies

    • Precipitation of ND3 along with interacting partners

    • Mass spectrometry identification of co-precipitated proteins

    • Verification of direct interactions via reciprocal co-IP

  • Cryo-electron microscopy:

    • Purification of intact Complex I from Oenothera berteriana mitochondria

    • Single-particle cryo-EM analysis to determine structure

    • Localization of ND3 within the complex

    • Identification of contact points with adjacent subunits

  • Genetic complementation studies:

    • Expression of mutant ND3 variants in systems lacking endogenous ND3

    • Assessment of Complex I assembly and function

    • Identification of critical residues for specific interactions

These approaches would provide comprehensive insights into the structural and functional relationships between ND3 and other Complex I components.

How can recombinant Oenothera berteriana ND3 be utilized to investigate mitochondrial disorders related to Complex I deficiency?

Recombinant Oenothera berteriana ND3 offers valuable research applications for investigating mitochondrial disorders related to Complex I deficiency:

  • Structural studies:

    • Purified recombinant ND3 can contribute to structural determination of plant Complex I

    • Comparative analysis with human ND3 to identify conserved functional domains

    • Mapping of disease-associated mutations onto protein structure

    • In silico modeling of mutation effects on protein stability and interactions

  • Functional complementation:

    • Expression of plant ND3 in mammalian cell models of Complex I deficiency

    • Assessment of functional conservation across kingdoms

    • Investigation of whether plant-specific features confer resistance to certain stressors

    • Development of hybrid complexes to identify functional domains

  • Biochemical mechanisms:

    • In vitro reconstitution studies with purified components

    • Analysis of electron transfer kinetics with wild-type and mutant variants

    • Investigation of ROS production under different conditions

    • Development of high-throughput assays for Complex I function

  • Therapeutic exploration:

    • Identification of small molecules that stabilize mutant Complex I

    • Investigation of plant-specific features that might inspire therapeutic approaches

    • Development of peptide-based interventions targeting specific interaction domains

    • Assessment of alternative oxidase interactions with Complex I components

These applications leverage the unique properties of plant ND3 proteins to provide insights into fundamental mechanisms of Complex I function relevant to both plant biology and human disease .

What are the most effective approaches for characterizing posttranslational modifications of recombinant Oenothera berteriana ND3?

Characterizing posttranslational modifications (PTMs) of recombinant Oenothera berteriana ND3 requires sophisticated techniques due to the protein's hydrophobic nature and membrane localization:

  • Mass spectrometry-based approaches:

    • Targeted proteomics using multiple reaction monitoring (MRM)

    • Electron transfer dissociation (ETD) fragmentation for improved PTM identification

    • Top-down proteomics of intact protein to preserve modification patterns

    • Enrichment strategies for specific modifications (phosphopeptides, acetylated peptides)

  • Site-specific analysis workflow:

    • Specialized extraction protocols using appropriate detergents

    • Optimized digestion strategies (combinations of proteases beyond trypsin)

    • Selective enrichment of modified peptides

    • Advanced MS/MS techniques with high mass accuracy

  • Modification-specific detection methods:

    • Phosphorylation: Pro-Q Diamond staining, phospho-specific antibodies

    • Acetylation: Acetyl-lysine antibodies

    • Oxidative modifications: Oxyblot procedures

    • Ubiquitination: Ubiquitin antibodies or tagged ubiquitin approaches

  • Functional correlation:

    • Site-directed mutagenesis of modified residues

    • Complex I activity assays with mutant variants

    • Analysis of protein-protein interactions affected by modifications

    • Assessment of protein stability and turnover

These approaches would help identify the constellation of PTMs on ND3 and their functional significance in regulating Complex I assembly, stability, and activity.

What strategies can overcome the challenges of crystallizing membrane proteins like ND3 for structural studies?

Membrane proteins like ND3 present significant crystallization challenges that can be addressed through several advanced strategies:

  • Protein engineering approaches:

    • Fusion with crystallization chaperones (e.g., T4 lysozyme, BRIL)

    • Truncation of disordered regions while preserving functional domains

    • Surface entropy reduction through mutation of flexible charged residues

    • Introduction of thermostabilizing mutations

  • Alternative crystallization methods:

    • Lipidic cubic phase (LCP) crystallization

    • Bicelle crystallization

    • Vapor diffusion with specialized detergent screens

    • Antibody fragment co-crystallization to provide crystal contacts

  • Detergent and lipid optimization:

    • Systematic screening of detergent types and concentrations

    • Addition of specific lipids to stabilize native conformation

    • Use of amphipols or nanodiscs to maintain native-like environment

    • Detergent exchange during purification to identify optimal conditions

  • Alternative structural approaches:

    • Single-particle cryo-electron microscopy

    • Solid-state NMR for specific structural elements

    • X-ray free electron laser (XFEL) studies of microcrystals

    • Integrative modeling combining low and high-resolution data

For ND3 specifically, focusing on the protein within the context of the entire Complex I or smaller subcomplexes may prove more successful than attempting to crystallize the isolated subunit, given its small size and dependence on neighboring subunits for stability.

How might interorganellar genetic transfers have shaped the evolution of the ND3 gene in Oenothera berteriana?

Interorganellar genetic transfers have played significant roles in shaping mitochondrial genomes in plants, potentially including the ND3 gene in Oenothera berteriana:

  • Plastid-to-mitochondrion transfers:

    • Oenothera mitochondrial genome contains sequences derived from the plastid genome, including part of the plastid rRNA cistron (2081 nucleotides containing the 3' half of the plastid 23S rRNA, adjacent intergenic region, and 4.5S rRNA)

    • These transferred sequences undergo secondary rearrangements within the mitochondrial genome

    • Evidence suggests these transfer events occurred in the distant evolutionary past

  • Sequence evolution rates:

    • Comparative analysis indicates faster sequence evolution in plastids than in mitochondria of Oenothera

    • Transferred sequences may show greater similarity to homologous regions in other species than to the current plastid sequences in the same species

  • Nuclear-mitochondrial interactions:

    • The presence of nuclear-derived sequences in the mitochondrial genome

    • Evidence for RNA-mediated transfer mechanisms rather than direct DNA transfer

    • Potential involvement of reverse transcriptase in facilitating these transfers

  • Functional implications:

    • Potential acquisition of novel regulatory elements

    • Creation of chimeric genes with new properties

    • Effects on transcription and RNA processing of mitochondrial genes

These processes contribute to the unique characteristics of the Oenothera berteriana mitochondrial genome and may have influenced the evolution of genes like ND3, potentially affecting their structure, regulation, and function.

What are the key challenges in accurately interpreting RNA editing patterns in ND3 across different plant species?

Interpreting RNA editing patterns in ND3 across different plant species presents several significant challenges:

  • Methodological limitations:

    • SSCP analysis may not detect all editing events, especially in complex editing patterns

    • Direct sequencing of RT-PCR products shows the dominant editing pattern but masks rare variants

    • Cloning introduces potential biases in representing the true population of editing variants

    • The cDNA-SSCP approach can improve detection but remains labor-intensive

  • Biological variables affecting interpretation:

    • Tissue-specific differences in editing efficiency

    • Developmental stage variations in editing patterns

    • Environmental influence on editing frequency

    • Nuclear background effects on editing machinery

  • Comparative analysis complexities:

    • Different species show drastically different numbers of editing sites (3 sites in radish versus 25-35 sites in Oenothera berteriana, Helianthus annuus, and Petunia hybrida)

    • Determining homologous editing sites across divergent species

    • Distinguishing ancestral versus derived editing events

    • Correlating editing patterns with functional consequences

  • Technical validation requirements:

    • Multiple independent cDNA clones needed to confirm editing frequencies

    • Verification through different methodological approaches

    • Controls to distinguish true editing from sequencing errors

    • Quantitative assessment of editing efficiency at each site

Addressing these challenges requires comprehensive approaches combining multiple techniques and careful experimental design to accurately characterize and interpret RNA editing patterns across species.

How might CRISPR-Cas9 technology be adapted for editing mitochondrial genes like ND3 in Oenothera berteriana?

Adapting CRISPR-Cas9 technology for mitochondrial gene editing in plants like Oenothera berteriana presents unique challenges requiring innovative solutions:

  • Delivery challenges and solutions:

    • Mitochondrial targeting of Cas9: Fusion with mitochondrial targeting sequences from native mitochondrial proteins

    • RNA import mechanisms: Utilize natural RNA import pathways by incorporating specific structural elements

    • Protein-RNA complex delivery: Development of mitochondria-penetrating peptides conjugated to ribonucleoprotein complexes

    • Alternative nucleases: Exploration of nucleases naturally found in mitochondria as editing tools

  • Design considerations:

    • Target site selection accounting for unique features of plant mitochondrial genomes

    • PAM site availability analysis within the ND3 sequence

    • Guide RNA design accounting for the high AT content of mitochondrial targeting sequences

    • Off-target prediction considering both nuclear and mitochondrial genomes

  • Verification strategies:

    • Development of mitochondria-specific PCR approaches to detect editing events

    • Next-generation sequencing of mitochondrial DNA populations

    • Functional assessment through Complex I activity assays

    • Proteomic verification of altered protein sequences

  • Alternative approaches:

    • Base editors with mitochondrial targeting

    • RNA editing tools to modify transcripts rather than DNA

    • Synthetic biology approaches using nuclear-encoded versions of mitochondrial genes

    • Mitoprimer-directed introduction of mutations during mitochondrial DNA replication

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.