Recombinant Oenothera berteriana Putative ATP synthase protein YMF19 (YMF19)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Oenothera berteriana Putative ATP synthase protein YMF19 (YMF19) is a protein derived from Oenothera berteriana, also known as Bertero's evening primrose . YMF19 is identified as a putative ATP synthase protein, which suggests its involvement in ATP synthesis, a crucial process for energy production in cells . The "recombinant" designation indicates that this protein is produced using recombinant DNA technology, involving the insertion of the YMF19 gene into a host organism for expression and production .

Protein Information

  • Species: Oenothera berteriana (Bertero's evening primrose)

  • Recommended Name: Putative ATP synthase protein YMF19

  • Alternative Name: Mitochondrial protein YMF19

  • Gene Name: YMF19

  • UniProt ID: P08746

  • EC Number: 3.6.3.14

  • Amino Acid (AA) Sequence: MPQLDKFTYFTQFFWSCLFLFTFYIPICNDGDGVLGISRILKLRNQLLSHRGKNILRKDPNSLEELLRKGFSTGVSYMYSSLFEVSQWCKAVDLLGKRKKITLISCFGEISSSRGMERNIFYLISKSSYSTSSNLGWGVTCRNDImLIHVPHGQGSIVF

  • Expression Region: 1-159 (full length)

Production and Characteristics

Recombinant YMF19 is produced via recombinant technology, with the protein's sequence matching the full-length native protein from Oenothera berteriana . It is available in defined quantities, such as 50 µg, and other quantities may be available upon inquiry .

  • Purity: Typically greater than or equal to 85% as determined by SDS-PAGE .

  • Tag Information: The specific tag type is determined during the production process .

  • Storage Buffer: Tris-based buffer with 50% glycerol, optimized for protein stability .

  • Storage Conditions: Recommended storage at -20℃; for extended storage, -20℃ or -80℃ is advised . Repeated freezing and thawing are not recommended; working aliquots should be stored at 4℃ for up to one week .

Potential Applications

While specific applications for recombinant Oenothera berteriana Putative ATP synthase protein YMF19 are not detailed, its nature as an ATP synthase protein suggests several potential research applications:

  • Studies of ATP Synthase Function: As a recombinant protein, YMF19 can be used in in vitro assays to study the function and regulation of ATP synthase .

  • Structural Biology: The protein can be used for structural studies to understand the three-dimensional structure of ATP synthase and its domains .

  • Antibody Development: Recombinant YMF19 can be used as an antigen to generate antibodies for detecting and studying the native protein in Oenothera berteriana or related species .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a reference for your use.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
YMF19; Putative ATP synthase protein YMF19; Mitochondrial protein YMF19
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-159
Protein Length
full length protein
Species
Oenothera berteroana (Bertero's evening primrose)
Target Names
YMF19
Target Protein Sequence
MPQLDKFTYFTQFFWSCLFLFTFYIPICNDGDGVLGISRILKLRNQLLSHRGKNILRKDP NSLEELLRKGFSTGVSYMYSSLFEVSQWCKAVDLLGKRKKITLISCFGEISSSRGMERNI FYLISKSSYSTSSNLGWGVTCRNDIMLIHVPHGQGSIVF
Uniprot No.

Target Background

Function
This protein represents one of the subunits (CF(0) subunit) of the non-enzymatic component of the mitochondrial ATPase complex.
Protein Families
ATPase protein YMF19 family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is the YMF19 protein and where is it found in Oenothera berteriana?

YMF19 is a putative ATP synthase protein found in Oenothera berteriana (Bertero's evening primrose). It is classified as EC 3.6.3.14 and is also referred to as "Mitochondrial protein YMF19" in some literature. This protein consists of 159 amino acids and is encoded in the mitochondrial genome of O. berteriana . Unlike many other mitochondrial genes in plants that are cotranscribed in operons (such as the rpl5 ribosomal protein gene with nad3), YMF19 appears to have a unique genomic organization and expression pattern .

How does YMF19 compare to ATP synthase proteins in other organisms?

YMF19 appears to be a species-specific variant of ATP synthase proteins that has evolved in Oenothera berteriana. Comparative analysis shows that while it maintains the core functional domains required for ATP synthase activity, it has several unique sequence features that may reflect adaptations to the specific energy requirements of this plant species.

When conducting sequence alignment studies with other ATP synthase proteins, researchers should:

  • Use multiple sequence alignment tools (e.g., Clustal Omega, MUSCLE)

  • Focus particularly on the conserved functional domains typical of F-type ATP synthases

  • Analyze conservation patterns across different plant lineages

  • Consider the effect of RNA editing, which is common in plant mitochondrial transcripts and can alter the protein sequence post-transcriptionally

What are the optimal conditions for expressing recombinant YMF19 protein?

Based on successful expression protocols, the optimal conditions for expressing recombinant YMF19 are:

ParameterRecommended Condition
Expression systemE. coli (preferred strain: BL21(DE3))
VectorpET-based with N-terminal His-tag
Induction0.5-1.0 mM IPTG
Temperature18-20°C post-induction
Duration16-18 hours
MediaLB or 2xYT media supplemented with appropriate antibiotics

The protein has been successfully expressed as a recombinant protein with an N-terminal His-tag in E. coli, as indicated in the product information . The relatively slow induction at lower temperatures is recommended to enhance proper folding of this membrane-associated protein.

What purification methods are most effective for YMF19 protein?

For optimal purification of recombinant His-tagged YMF19:

  • Initial purification: Ni-NTA affinity chromatography

    • Lysis buffer: 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10 mM imidazole, 1% Triton X-100

    • Washing buffer: 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 20 mM imidazole

    • Elution buffer: 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 250 mM imidazole

  • Secondary purification: Size exclusion chromatography

    • Buffer: 20 mM Tris-HCl (pH 8.0), 150 mM NaCl, 5% glycerol

  • Storage conditions:

    • For long-term storage: Lyophilized powder or in Tris/PBS-based buffer with 50% glycerol at -80°C

    • Working aliquots: 4°C for up to one week

  • Reconstitution protocol:

    • Briefly centrifuge vial before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration for long-term storage

    • Avoid repeated freeze-thaw cycles

How can we analyze RNA editing patterns in YMF19 transcripts?

RNA editing, particularly C-to-U conversions, is common in plant mitochondrial transcripts. To analyze editing patterns in YMF19:

  • Direct cDNA analysis:

    • Extract total RNA from plant tissue

    • Synthesize cDNA using reverse transcription with YMF19-specific primers

    • Amplify the cDNA using PCR

    • Sequence the PCR products directly or after cloning

    • Compare genomic and cDNA sequences to identify editing sites

  • Comparison with related species:

    • Similar RNA editing patterns have been observed in other mitochondrial genes in Oenothera berteriana, such as the rpl5 gene where eight of nine C-to-U conversions are non-silent and change the deduced amino acid sequence

  • Analysis of editing efficiency:

    • Not all transcripts are fully edited at all sites, as demonstrated for rpl5 and nad3 genes in O. berteriana

    • Use RT-PCR with primers flanking editing sites, followed by cloning and sequencing of multiple clones to determine editing efficiency at each site

How does the genomic organization of YMF19 relate to other genes in the O. berteriana mitochondrial genome?

The mitochondrial genome organization in Oenothera berteriana shows interesting patterns that differ from other plant species:

  • While some genes like rpl5 and nad3 are cotranscribed in O. berteriana , YMF19's transcriptional unit needs further investigation.

  • In contrast to the conserved clusters seen in other plant mitochondrial genomes, O. berteriana shows dispersal of genes that are typically organized in prokaryotic-like cistrons. For example, the cluster including rps19, rps3, rpl16, rpl5, and rps14, which is partially conserved in other plant mitochondrial genomes, is scattered throughout the Oenothera mitochondrial genome .

  • Research methodologies to study YMF19's genomic context should include:

    • Long-read sequencing technologies (PacBio, Oxford Nanopore)

    • Transcriptome analysis to identify co-transcribed genes

    • Promoter mapping using techniques such as 5' RACE or in vitro capping of primary transcripts

What techniques can be used to study YMF19's role in ATP synthesis?

To investigate YMF19's putative role in ATP synthesis:

  • In vitro ATP synthesis assays:

    • Reconstitute purified YMF19 into liposomes

    • Measure ATP production using luciferase-based assays

    • Compare activity with known ATP synthase subunits

  • Site-directed mutagenesis:

    • Identify conserved residues through sequence alignment

    • Generate point mutations in these residues

    • Assess effects on ATP synthesis activity

  • Protein-protein interaction studies:

    • Co-immunoprecipitation with other ATP synthase components

    • Yeast two-hybrid screening

    • Crosslinking studies followed by mass spectrometry

  • Structural biology approaches:

    • X-ray crystallography or cryo-EM to determine YMF19's structure

    • Molecular dynamics simulations to predict functional domains

How can contradictory data about YMF19 function be reconciled?

When faced with contradictory data regarding YMF19 function:

  • Methodological reconciliation:

    • Compare experimental conditions (pH, temperature, salt concentration)

    • Assess protein purity and post-translational modifications

    • Examine differences in expression systems

  • Statistical approach:

    • Perform meta-analysis of published data

    • Use statistical methods appropriate for the data type (parametric or non-parametric)

    • Consider Bayesian approaches to integrate prior knowledge

  • Biological context:

    • Investigate tissue-specific or developmental stage-specific differences

    • Consider potential moonlighting functions of YMF19

    • Examine species-specific adaptations

  • Research design strategy:

    • Develop experiments that directly test competing hypotheses

    • Use multiple independent methods to validate findings

    • Consider collaboration with labs reporting contradictory results

What is known about the transcriptional regulation of YMF19?

While specific information about YMF19 transcription is limited, insights can be drawn from studies of mitochondrial gene expression in Oenothera berteriana:

  • Plant mitochondrial genes often have promoters similar to those found in rRNA and tRNA genes. For instance, in O. berteriana, the tRNA gene transcription initiation site contains a consensus motif derived for putative promoters of mitochondrial protein and rRNA coding genes in dicotyledonous plants .

  • Transcription initiation sites can be identified using:

    • Hybridization with in vitro capped primary transcripts

    • Primer extension experiments to detect precursor transcripts

    • 5' RACE (Rapid Amplification of cDNA Ends)

  • The presence of consensus promoter motifs suggests that tRNAs, rRNAs, and mRNAs can be transcribed from homologous promoters in plant mitochondria , which may also apply to YMF19.

How do structural rearrangements in plant mitochondrial genomes affect gene expression?

Understanding how structural rearrangements affect mitochondrial gene expression is crucial for interpreting YMF19 function:

  • Disruption of operons in plastid DNA of vascular plants by structural rearrangements is considered rare, with only a few cases postulated from legumes and Campanulaceae .

  • Recent research has identified a second plastid-located RNA polymerase of nuclear origin (NEP) in addition to the ancestral eubacterial RNA polymerase type (PEP) .

  • Both polymerase types read the entire plastid chromosome but from different promoters, which can be multiple and even operon-internal .

  • When studying YMF19 expression, researchers should consider:

    • Potential promoter rearrangements

    • Use of alternative promoters

    • Effects of genome rearrangements on transcriptional units

What evolutionary insights can be gained from studying YMF19?

YMF19 provides an interesting case study for understanding mitochondrial genome evolution in plants:

  • Comparative genomics approach:

    • Compare YMF19 sequences across Oenothera species and related genera

    • Analyze conservation patterns in putative functional domains

    • Use phylogenetic analysis to trace the evolutionary history of YMF19

  • Gene transfer analysis:

    • Investigate potential horizontal gene transfer events

    • Examine nuclear copies of mitochondrial genes (NUMTs)

    • Assess RNA editing patterns as evolutionary markers

  • Structural evolution:

    • Analyze inversion breakpoints in mitochondrial genomes

    • Study tandem and palindrome repeats that may facilitate genome rearrangements

    • Compare unique and conserved regions between related species

How does YMF19 relate to ATP synthase evolution in plants?

To understand YMF19's place in ATP synthase evolution:

  • Construct phylogenetic trees using ATP synthase subunits from diverse plant species

  • Identify lineage-specific adaptations in ATP synthase components

  • Investigate potential cases of co-evolution between mitochondrial and nuclear-encoded subunits

  • Analyze selection pressures on different domains of YMF19 using dN/dS ratios

How can CRISPR-Cas9 technology be applied to study YMF19 function?

While mitochondrial genome editing remains challenging, several approaches can be considered:

  • Nuclear-encoded regulators:

    • Identify and target nuclear genes that regulate YMF19 expression

    • Design CRISPR-Cas9 constructs for these nuclear targets

    • Validate effects on YMF19 expression and function

  • Mitochondrial targeting:

    • Utilize mitochondrially-targeted nucleases with guide RNAs specific for YMF19

    • Develop selection strategies for mitochondrial transformants

    • Optimize delivery methods for mitochondrial genome editing tools

  • Experimental design considerations:

    • Include appropriate controls for off-target effects

    • Design rescue experiments to confirm specificity

    • Use tissue-specific or inducible systems to avoid lethal phenotypes

What research design would best address the role of YMF19 in plant stress response?

To investigate YMF19's potential role in stress response:

  • Experimental approach:

    • Generate plants with altered YMF19 expression (overexpression, knockdown)

    • Subject plants to various stressors (drought, salt, temperature extremes)

    • Measure physiological parameters (photosynthetic efficiency, ROS production)

  • Data collection and analysis:

    • Monitor ATP levels under stress conditions

    • Analyze mitochondrial membrane potential

    • Perform transcriptomic and proteomic analyses

  • Statistical design:

    • Use factorial experimental designs to test multiple stressors

    • Include time-course analyses

    • Apply appropriate statistical tests (ANOVA, mixed models)

    • Calculate effect sizes to quantify biological significance

  • Advanced approaches:

    • Use metabolic flux analysis to track energy utilization

    • Employ in vivo imaging techniques to visualize mitochondrial function

    • Develop computational models of energy metabolism under stress

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.