Recombinant Oenothera biennis Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
34-318
Protein Length
Full Length of Mature Protein
Species
Oenothera biennis (German evening primrose) (Onagra biennis)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDRQVKQV LANGKKGGLNVGAVLILPEGFELAPPARISPEMKERIGNPSFQSYRPTKKNILVIGPVPG QKYSEITFPILSPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGIVS KIIRKEKGGYEITITDASDGRQVVDIIPSGPELLVSEGESIKLDQPLTSNPNVGGFGQGD AEVVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f (petA) in Oenothera biennis and what is its genomic organization?

Apocytochrome f (petA) is a critical protein component of the cytochrome b6f complex in the photosynthetic electron transport chain of Oenothera biennis (German evening primrose). The gene encoding pre-apocytochrome f has been mapped to a 2.4 kbp HindIII fragment of the circular plastid chromosome of Oenothera species. It is strategically located distal to the gene for ATP synthase subunit alpha, at the border of a 45 kbp inversion that distinguishes Oenothera plastid chromosomes from other plant species . This genomic organization is particularly significant as it affects gene expression and protein functionality in the context of photosynthesis.

The gene contains a single open reading frame encoding 318 amino acids, of which 285 comprise the mature polypeptide while the remaining 33 residues constitute an N-terminal signal sequence that is 2 residues shorter than those found in spinach, wheat, and pea proteins . This structure is essential for proper protein targeting and function within the chloroplast.

What expression systems are most effective for producing recombinant Oenothera biennis Apocytochrome f?

The production of functional recombinant Oenothera biennis Apocytochrome f presents specific challenges due to its membrane-associated nature and requirement for proper post-translational processing. Researchers have successfully employed several expression systems, each with distinct advantages depending on the experimental objectives.

The most effective expression systems include:

Expression SystemAdvantagesLimitationsTypical Yield
E. coli (BL21)High yield, rapid growth, economicalLacks post-translational modifications, inclusion body formation5-10 mg/L culture
Yeast (P. pastoris)Post-translational modifications, secretion possibleLonger production time, more complex media2-5 mg/L culture
Insect cells (Sf9)More complex modifications, proper foldingExpensive, technically demanding1-3 mg/L culture
Plant-based (N. benthamiana)Native-like processing and foldingLower yields, longer production time0.5-2 mg/L fresh weight

When expressing recombinant apocytochrome f, it's essential to consider the inclusion of the transit peptide sequence, as this affects protein processing and targeting. For structural studies requiring high purity, bacterial expression systems with subsequent refolding protocols have proven most efficient, while functional studies may benefit from eukaryotic expression systems that better recapitulate the native protein environment.

What purification strategies yield the highest purity recombinant Apocytochrome f?

Purification of recombinant Apocytochrome f requires careful consideration of its biophysical properties. The protein contains hydrophobic transmembrane domains that necessitate specialized purification approaches. A multi-step purification strategy typically yields the best results:

  • Initial extraction using mild detergents (n-dodecyl-β-D-maltoside or Triton X-100) to solubilize membrane-associated proteins

  • Affinity chromatography utilizing histidine or other fusion tags

  • Ion exchange chromatography to separate based on charge differences

  • Size exclusion chromatography as a final polishing step

This protocol typically results in >95% pure protein suitable for biochemical and structural studies. When working with Oenothera biennis Apocytochrome f specifically, researchers should pay particular attention to maintaining the integrity of the heme-binding region during purification by including reducing agents and avoiding harsh pH conditions.

How does the structure of Oenothera biennis Apocytochrome f compare to that of other species?

While a high-resolution crystal structure specific to Oenothera biennis Apocytochrome f has not been published, comparative structural analysis can be performed based on the high sequence conservation (>80%) with other plant species . The protein adopts a structure featuring a large hydrophilic domain exposed to the lumen, a transmembrane helix, and a small domain in the stromal side of the thylakoid membrane.

Key structural features include:

  • A heme-binding domain containing the CXXCH motif essential for covalent attachment of heme

  • A large lumen-exposed domain involved in interactions with plastocyanin

  • A single transmembrane helix anchoring the protein to the thylakoid membrane

  • A small stromal domain possibly involved in complex assembly

The unique features of Oenothera biennis Apocytochrome f may include subtle differences in surface residues that could affect protein-protein interactions specific to this species' photosynthetic apparatus. These structural nuances may contribute to the adaptability of Oenothera biennis to different environmental conditions.

What techniques are most effective for investigating protein-protein interactions involving Apocytochrome f?

Investigating the protein-protein interactions of Apocytochrome f requires approaches that can capture both transient and stable interactions within the photosynthetic apparatus. Several complementary techniques have proven effective:

TechniqueApplicationResolutionSample Requirement
Surface Plasmon ResonanceBinding kineticsModeratePurified proteins, 0.1-1 mg
Co-immunoprecipitationIn vivo interactionsLowThylakoid extracts, 5-10 mg
Crosslinking Mass SpectrometryInteraction interfacesHighPurified complexes, 0.5-2 mg
Förster Resonance Energy TransferDynamic interactionsHighRecombinant labeled proteins
Cryo-electron MicroscopyComplex architectureVery highPurified complexes, 0.1-0.5 mg

For Oenothera biennis specifically, researchers have found that mild solubilization conditions using digitonin rather than stronger detergents better preserve native interactions between Apocytochrome f and other components of the cytochrome b6f complex. This approach has revealed species-specific interaction patterns that may relate to the unique genetic features of Oenothera species.

How does the genomic context of petA in Oenothera contribute to understanding plastid genome evolution?

The petA gene in Oenothera occupies a particularly significant position in the plastid genome, residing at the border of a 56 kb inversion in the Large Single Copy (LSC) region that distinguishes Oenothera plastomes from other plant species. This inversion occurs in the intergenic regions between the accD/rbcL and rps16/trnQ UUG genes and reverses the order of genes between rbcL and trnQ UUG . This genomic rearrangement provides valuable insights into plastid genome evolution and the mechanisms of genomic restructuring in chloroplasts.

Oenothera's plastome structure has additional unique features including two copies of the initiator tRNA trnfM CAU which differ by a single nucleotide polymorphism in plastomes I, II, III, and IV . These features make Oenothera an excellent model for studying the impacts of genomic rearrangements on gene expression and function.

The evolutionary implications of these genomic features are profound, as they contribute to the unique genetic system of Oenothera that enables biparental plastid transmission and the formation of plastome-genome incompatibilities between species . This makes the genus a powerful model for studying speciation mechanisms at the molecular level.

What does the conservation of Apocytochrome f reveal about evolutionary constraints on photosynthetic proteins?

The high degree of sequence conservation observed in Apocytochrome f across diverse plant species (>80% amino acid identity) reveals strong evolutionary constraints operating on photosynthetic proteins . This conservation extends to Oenothera species despite their unique genomic features and evolutionary history. Several lines of evidence indicate that this conservation is maintained by strong purifying selection:

  • The core functional domains show the highest conservation, particularly residues involved in heme binding and electron transfer

  • The transmembrane region demonstrates stronger conservation of physicochemical properties rather than exact sequence identity

  • Surface-exposed residues involved in protein-protein interactions show greater variability while maintaining interaction capacity

Synonymous and non-synonymous substitution rates (Ka/Ks ratios) for the petA gene across Oenothera plastomes indicate strong purifying selection, with Ka/Ks values typically well below 1.0 . This pattern of conservation amidst genomic rearrangements highlights the essential nature of cytochrome f function in photosynthesis and the limited tolerance for functional modifications despite extensive genomic restructuring.

How can recombinant Oenothera biennis Apocytochrome f be utilized in photosynthesis research?

Recombinant Oenothera biennis Apocytochrome f serves as a valuable tool for investigating fundamental aspects of photosynthesis. Its applications extend across multiple research areas:

  • Electron transport studies: Purified recombinant protein can be reconstituted into liposomes or nanodiscs to measure electron transfer rates and mechanisms under controlled conditions. This allows researchers to assess how specific amino acid substitutions affect electron transport efficiency.

  • Assembly studies of cytochrome b6f complex: Recombinant apocytochrome f can be used to investigate the assembly pathway of the cytochrome b6f complex, particularly in the context of Oenothera's unique plastid genetics.

  • Protein-protein interaction mapping: The protein can be employed as bait in pull-down assays to identify novel interaction partners specific to Oenothera biennis, potentially revealing species-specific regulatory mechanisms.

  • Comparative functional analysis: By comparing the properties of Oenothera biennis Apocytochrome f with those from other species, researchers can identify subtle functional adaptations that might contribute to the ecological success of evening primrose in diverse environments.

  • Structure-function relationship studies: Site-directed mutagenesis of recombinant protein allows for systematic analysis of how specific residues contribute to function, stability, and interactions with other photosynthetic components.

These applications are particularly valuable in the context of Oenothera's unique genetic system, which allows researchers to create novel plastid-nuclear combinations and study their functional consequences.

What insights does Oenothera biennis Apocytochrome f provide for understanding plastome-genome incompatibility?

Oenothera biennis Apocytochrome f plays a crucial role in understanding plastome-genome incompatibility, a phenomenon central to speciation mechanisms in this genus. The genus Oenothera exhibits biparental transmission of plastids and the ability to exchange plastids and nuclei between species, often resulting in plastome-genome incompatibility . Several key insights have emerged from studying petA in this context:

  • Sequence variations in petA between Oenothera species can contribute to functional incompatibilities when combined with nuclear backgrounds from different species, affecting photosynthetic efficiency and plant fitness.

  • The positioning of petA near an inversion breakpoint makes it potentially susceptible to expression changes when placed in different nuclear backgrounds, possibly contributing to compatibility issues.

  • Post-translational processing of pre-apocytochrome f involves interactions between plastid-encoded signals and nuclear-encoded processing machinery, creating another potential point of incompatibility.

These insights are particularly valuable because Oenothera is uniquely suited for studying speciation processes due to its combination of genetic features, including wide interspecific crossing capability, biparental organelle transmission, and the capacity to generate fertile interspecific plastome-genome hybrids .

What are the optimal conditions for measuring the functional activity of recombinant Apocytochrome f?

Assessing the functional activity of recombinant Apocytochrome f requires careful consideration of experimental conditions that mimic its native environment. Optimal conditions include:

ParameterOptimal RangeCritical Considerations
pH6.8-7.2Matches thylakoid lumen during electron transport
Temperature25-30°CBalances activity with stability
Ionic strength100-150 mMMaintains proper electrostatic interactions
Reducing environment0.5-2 mM DTT or 2-5 mM β-mercaptoethanolMaintains heme in reduced state
Lipid environment20-30% MGDG, 15-20% DGDGMimics thylakoid membrane composition

When measuring electron transfer activity, researchers typically employ artificial electron donors and acceptors coupled with spectrophotometric detection of redox changes. For Oenothera biennis Apocytochrome f, plastocyanin from the same species is the preferred electron acceptor for the most physiologically relevant measurements, though artificial acceptors like potassium ferricyanide can be used for comparative studies.

Activity measurements should include appropriate controls, particularly comparisons with the native protein isolated from Oenothera biennis thylakoids, to verify that the recombinant protein exhibits comparable functional characteristics.

How can site-directed mutagenesis be applied to study structure-function relationships in Oenothera biennis Apocytochrome f?

Site-directed mutagenesis represents a powerful approach for investigating structure-function relationships in Oenothera biennis Apocytochrome f. Strategic mutation targets include:

  • Heme-binding residues: Mutations in the CXXCH motif to assess the contribution of heme coordination to protein stability and electron transfer rates.

  • Surface residues: Mutations at the lumenal domain to probe interactions with plastocyanin and evaluate species-specific recognition features.

  • Transmembrane domain: Substitutions affecting membrane anchoring to study the importance of specific positioning within the thylakoid.

  • Processing site residues: Modifications at the junction between the transit peptide and mature protein to investigate species-specific differences in processing efficiency.

When designing mutagenesis experiments, researchers should consider both conservative substitutions that maintain physicochemical properties and non-conservative changes that significantly alter them. Comparative analysis with mutations at equivalent positions in Apocytochrome f from other species can reveal evolutionary constraints specific to Oenothera biennis.

Functional assays following mutagenesis should include measurements of electron transfer rates, protein stability, complex assembly efficiency, and interaction strength with partner proteins to provide a comprehensive assessment of the mutational effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.