Recombinant Oenothera biennis ATP synthase subunit a, chloroplastic (atpI)

What is the structural composition of Oenothera biennis ATP synthase subunit a?

Oenothera biennis ATP synthase subunit a (atpI) is a 247 amino acid membrane protein that forms part of the F₀ sector of chloroplast ATP synthase. The amino acid sequence is: MDVLSCSNNTLKGLYDISGVEVGQHFYWQIGGFQVHGQVLITSWVVIAILLGSASIAVRN PQTIPNDSQNFFEYILEFIRDVSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKLV ELPHGELAAPTNDINTTVALALLTSVAYFYAGLSKKGLGYFSKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH . The protein contains multiple transmembrane domains that anchor it within the thylakoid membrane, where it participates in proton translocation essential for ATP synthesis.

How does the atpI subunit interact with other components of the ATP synthase complex?

The atpI subunit interacts primarily with the c-ring (c₁₄) within the membrane sector of the ATP synthase. Structural studies have revealed that subunit a forms close contacts with the rotating c-ring subunits, creating the pathway for proton translocation . Additionally, it makes contacts with subunit b and b' to form the peripheral stalk that connects the membrane-embedded F₀ portion with the F₁ catalytic head. These interactions are critical for maintaining the structural integrity of the complex while allowing the rotational catalysis mechanism to function efficiently.

How is the atpI gene expression regulated in Oenothera biennis?

In Oenothera biennis, as in other land plants, the atpI gene is encoded by the plastid genome and arranged into plastid operons . Its expression is coordinated with other plastid-encoded ATP synthase subunits to ensure appropriate complex stoichiometry. The regulation involves both transcriptional and post-transcriptional mechanisms, including light-dependent regulation and developmental cues. The expression is tightly regulated to prevent the accumulation of unassembled subunits, which could lead to wasteful ATP hydrolysis or proton gradient uncoupling.

How do redox modifications affect the function of chloroplast ATP synthase containing the atpI subunit?

Chloroplast ATP synthase possesses a unique redox regulation mechanism that modulates its activity between day and night conditions . While the redox switch is primarily located on the γ subunit with regulatory cysteines that form a disulfide bridge in the oxidized state, the conformational changes resulting from this redox modification affect the entire complex, including the proton-conducting pathway involving subunit a (atpI) .

Cryo-EM studies have demonstrated that in the oxidized state, the disulfide linkage introduces a torsional constraint that stabilizes β hairpin structures, restricting the enzyme's rotational flexibility . When reduced, this constraint is alleviated, allowing a more fluid transition between rotary states, enhancing ATP synthesis efficiency. This redox regulation ensures that ATP hydrolysis is limited during the night when photosynthesis is inactive, preventing wasteful energy consumption .

What experimental approaches are most effective for studying the integration of recombinant atpI into functional ATP synthase complexes?

The study of atpI integration into functional ATP synthase complexes requires a multi-faceted approach:

• Liposome Reconstitution Systems: Purified recombinant atpI can be reconstituted into liposomes along with other ATP synthase subunits to assess functional integration. The ΔpH-step jump method can be used to establish a proton gradient across the membrane to measure ATP synthesis activity .

• Cryo-EM Structural Analysis: Single-particle cryo-EM has proven highly effective for determining the structural organization of ATP synthase complexes containing the atpI subunit under different conditions (e.g., reduced vs. oxidized states) .

• Mutational Analysis: Site-directed mutagenesis of conserved residues in the atpI protein, followed by functional assays, can identify critical amino acids involved in proton translocation or subunit interactions.

• In vitro Assembly Assays: Combining recombinant atpI with other ATP synthase components in the presence of chaperones like CPN60, HSP70, and assembly factors such as BFA1 or PAB can provide insights into the assembly process .

• Cross-linking Studies: Chemical cross-linking coupled with mass spectrometry can identify interaction partners and contact points between atpI and other subunits within the assembled complex.

What are the implications of atpI modifications for enhancing photosynthetic efficiency?

Engineering the atpI subunit presents opportunities for optimizing photosynthetic efficiency, particularly under stress conditions . Modifications to the proton-conducting pathway could potentially alter the proton/ATP ratio, affecting the balance between ATP synthesis and the maintenance of the proton motive force.

Targeted modifications of atpI could:

• Alter the ATP synthase activity to match the demands of carbon fixation under varying environmental conditions

• Optimize the proton conductance to improve energy conversion efficiency

• Enhance the stability of the ATP synthase complex under stress conditions

How does the evolutionary conservation of atpI across plant species inform structure-function relationships?

Comparative analysis of atpI sequences across plant species reveals highly conserved regions that likely correspond to functionally critical domains. The conservation pattern of the atpI subunit across green lineage organisms (from cyanobacteria to land plants) indicates that the basic mechanism of proton translocation has been preserved throughout evolution .

Sequence alignments between Oenothera biennis atpI and homologous proteins from other species can identify:

• Conserved transmembrane helices involved in proton channel formation

• Residues critical for interaction with the c-ring

• Regions involved in peripheral stalk assembly

This evolutionary conservation analysis can guide targeted engineering efforts and help predict the functional consequences of specific mutations. Additionally, understanding the minor variations in atpI across species adapted to different environmental conditions may provide insights into natural strategies for optimizing ATP synthase function under various stresses.

What are the optimal conditions for expression and purification of recombinant Oenothera biennis atpI?

Expressing and purifying recombinant membrane proteins like atpI presents significant challenges. The optimal approach involves:

• Expression System Selection: While E. coli systems are commonly used, expression of chloroplast membrane proteins often benefits from chloroplast-specific characteristics found in algal or plant-based expression systems.

• Solubilization Strategies:

  • Use of mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin

  • Nanodiscs or styrene-maleic acid lipid particles (SMALPs) can preserve the native lipid environment

  • Bicelles may provide a more native-like environment than micelles

• Purification Protocol:

  • Initial purification via affinity chromatography (His-tag is commonly used)

  • Size exclusion chromatography to separate properly folded protein from aggregates

  • Ion exchange chromatography to achieve high purity

• Stabilization Conditions:

  • Storage in a Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for long-term storage

  • Avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

What assays are most reliable for measuring the functional activity of recombinant atpI in reconstituted systems?

Several complementary assays can assess the functional activity of atpI:

• ATP Synthesis Assays:

  • Luciferin-luciferase assay to quantify ATP production in reconstituted liposomes with established pH gradients

  • Measurement of ATP synthesis rates under different redox conditions

  • Coupled enzyme assays monitoring NADPH production

• Proton Translocation Measurements:

  • pH-sensitive fluorescent dyes to monitor proton movement

  • Patch-clamp techniques for direct measurement of proton currents

• Rotational Catalysis Assessment:

  • Single-molecule FRET to monitor conformational changes

  • Fluorescence microscopy with attached beads to visualize rotation

• Structural Integrity Verification:

  • Native PAGE to confirm complex assembly

  • Cross-linking followed by mass spectrometry to verify subunit interactions

  • Cryo-EM for structural validation of the assembled complex

How can researchers effectively study the interaction between atpI and other ATP synthase subunits?

Understanding the interactions between atpI and other ATP synthase subunits requires multiple complementary approaches:

• Co-immunoprecipitation (Co-IP):

  • Using antibodies against atpI or against other subunits to pull down interacting partners

  • Western blotting to identify co-precipitated proteins

• Yeast Two-Hybrid (Y2H) Adaptations:

  • Modified Y2H systems designed for membrane proteins can identify binary interactions

  • Split-ubiquitin assays that are more suitable for membrane proteins

• Förster Resonance Energy Transfer (FRET):

  • Labeling atpI and potential interacting partners with appropriate fluorophores

  • Measuring energy transfer as evidence of close proximity

• Cross-linking Mass Spectrometry:

  • Chemical cross-linking to capture transient or stable interactions

  • Mass spectrometry to identify cross-linked peptides and map interaction interfaces

• Cryo-EM Studies:

  • Single-particle analysis to visualize interactions in the native complex

  • Local refinement of regions involving atpI to improve resolution of interaction interfaces

• Molecular Dynamics Simulations:

  • In silico modeling of atpI interactions with other subunits

  • Prediction of stable conformations and interaction energies

How can researchers overcome stability issues when working with recombinant atpI?

The hydrophobic nature of atpI presents significant stability challenges that can be addressed through:

• Buffer Optimization:

  • Screening different buffer compositions (pH, salt concentration, additives)

  • Addition of glycerol (typically 10-50%) to enhance stability

  • Incorporation of specific lipids that interact with atpI in its native environment

• Temperature Control:

  • Maintaining samples at 4°C during purification steps

  • Avoiding repeated freeze-thaw cycles

  • Using controlled, gradual freezing for long-term storage

• Protein Engineering Approaches:

  • Introduction of stabilizing mutations based on structural information

  • Fusion with solubilizing partners that can be later cleaved

  • Creation of chimeric proteins with more stable homologs for specific domains

• Reducing Aggregation:

  • Addition of low concentrations of non-ionic detergents

  • Use of arginine as an aggregation suppressor

  • Implementation of size-exclusion chromatography steps to remove aggregates

What strategies can address the challenges in obtaining high-resolution structural data for atpI?

Obtaining high-resolution structural data for membrane proteins like atpI presents unique challenges:

• Sample Preparation Optimization:

  • Testing various detergents and nanodiscs formulations

  • Addition of lipids that stabilize the native conformation

  • Use of tentoxin or other inhibitors to limit flexibility and obtain higher resolution

• Cryo-EM Approaches:

  • Collection of large datasets to capture multiple conformational states

  • Use of phase plates to enhance contrast

  • Implementation of motion correction and particle classification techniques

  • Local refinement focused on the membrane domain

• Crystallization Alternatives:

  • Lipidic cubic phase crystallization attempts

  • Engineering of crystallization constructs with soluble domains

  • Co-crystallization with antibody fragments to increase polar surfaces

• Complementary Structural Methods:

  • Solid-state NMR for specific domains or interactions

  • EPR spectroscopy with site-directed spin labeling

  • Cross-linking mass spectrometry to constrain computational models

How can researchers differentiate between functional and non-functional recombinant atpI in experimental systems?

Distinguishing functional from non-functional recombinant atpI requires multiple validation approaches:

• Functional Assays:

  • ATP synthesis measurements in reconstituted systems

  • Proton translocation assays using pH-sensitive dyes

  • Comparison with wild-type activity levels

• Structural Validation:

  • Circular dichroism to confirm proper secondary structure

  • Limited proteolysis to assess folding quality

  • Native PAGE to verify complex formation

• Binding Assays:

  • Verification of interaction with known binding partners (c-ring subunits, peripheral stalk components)

  • Surface plasmon resonance to measure binding affinities

  • Pull-down assays to confirm complex formation

• Thermal Stability Assessment:

  • Differential scanning fluorimetry to measure stability

  • Comparison with native protein thermal denaturation profiles

  • Assessment of stability in different detergent and lipid environments