Recombinant Oenothera biennis Cytochrome c biogenesis protein ccsA (ccsA)

Shipped with Ice Packs
In Stock

Description

Evolutionary and Genomic Insights

  • Plastome Localization: The ccsA gene resides in the small single-copy (SSC) region of Oenothera plastomes, flanked by conserved regions like ycf1 and accD .

  • Positive Selection: Comparative studies identified ccsA as one of four chloroplast genes under positive selection in Oenothera, suggesting adaptive evolution in cytochrome assembly pathways .

  • Gene Family Dynamics: Rapid evolution of phenolic metabolism genes in O. biennis correlates with ecological adaptation, though ccsA remains conserved due to its essential role .

Research Applications

  • Cytochrome Assembly Studies: Used to investigate heme attachment mechanisms in chloroplasts, particularly in mutants like Chlamydomonas reinhardtii ccs strains .

  • Structural Biology: Recombinant ccsA enables crystallization and molecular dynamics studies of transmembrane heme lyases .

  • Biotechnological Tools: Commercial availability (e.g., MyBioSource, Creative BioMart) supports high-throughput screening and antibody development .

Challenges and Future Directions

  • Stability Issues: The protein is prone to degradation if subjected to repeated freeze-thaw cycles, necessitating optimized storage protocols .

  • Functional Redundancy: Nuclear-encoded CCS1–CCS4 proteins interact with ccsA, complicating mechanistic studies of heme ligation .

  • Agricultural Relevance: Potential engineering of ccsA to enhance photosynthetic efficiency in crops, leveraging Oenothera’s drought tolerance .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ccsA; Cytochrome c biogenesis protein CcsA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Oenothera biennis (German evening primrose) (Onagra biennis)
Target Names
ccsA
Target Protein Sequence
MIFYTLEHILTHISFSLVSIGITIFLITLSVDEIIGLYDSSEKGVIGTFLCITGLLVTRW AYSGHFPLSNLYESLLFLSWSFAIIHMFPYFKKQKSYVRTITSSSTIFTQGLVTSGLLSE MQQSEILVPALQSQWLMMHVSMMVLGYAALLCGSLLSVALLVITFRKALRIFSKKKAFLK DSFSFVEIQYRNEPSNVLLSTSFISSKNYYRAQLIQQLDRWSSRIISLGFIFLTIGILSG AVWANEAWGSYWNWDPKETWAFITWTMFAIYLHTRTNPNFQSVNSAIVAFLGFIIIWICY FGVNLLGIGLHSYGSFNLH
Uniprot No.

Target Background

Function
Essential for the biogenesis of c-type cytochromes (cytochrome c6 and cytochrome f), specifically during heme attachment.
Protein Families
CcmF/CycK/Ccl1/NrfE/CcsA family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is cytochrome c biogenesis protein ccsA in Oenothera biennis?

Cytochrome c biogenesis protein ccsA in Oenothera biennis is a membrane-bound component of the System II (or CCS system) cytochrome c maturation pathway found in the thylakoid membrane of plastids. It belongs to the CCS (cytochrome c synthesis) gene family that is responsible for the covalent attachment of heme to apocytochromes c in the thylakoid lumen . In O. biennis, ccsA is encoded by the plastid genome and plays an essential role in photosynthesis by facilitating the maturation of cytochromes c, including cytochrome f and cytochrome c6, which function as electron carriers in photosynthetic processes . The protein contains several transmembrane domains and is believed to function as a heme delivery component, transporting heme across the thylakoid membrane to the site of cytochrome maturation in the lumen.

How does ccsA contribute to cytochrome c maturation in plants?

CcsA functions as part of a multiprotein complex in the System II cytochrome c maturation pathway. This pathway is responsible for the stereospecific attachment of ferroheme to apocytochromes c via thioether linkages in the thylakoid lumen . The process involves several coordinated steps: First, apocytochrome and heme must be independently transported across the thylakoid membrane. CcsA is believed to form a channel or transporter for heme delivery to the lumen side of the thylakoid membrane. Once in the lumen, the CXXCH heme-binding motif of the apocytochrome undergoes stereospecific attachment to the vinyl groups of heme via thioether bonds . CcsA works in concert with other CCS proteins to ensure the correct orientation and proximity of heme to the apocytochrome, enabling the formation of these covalent bonds. This maturation process is critical for the function of cytochromes c as electron carriers in photosynthesis and other metabolic processes.

What structural features characterize the ccsA protein in Oenothera biennis?

The ccsA protein in Oenothera biennis shares structural features common to ccsA proteins in other photosynthetic organisms. It is a polytopic membrane protein with multiple transmembrane domains spanning the thylakoid membrane. Key structural features include:

  • A conserved WWD domain (tryptophan-tryptophan-aspartate) located on the lumen-facing side of the protein, which is believed to be involved in heme binding and presentation

  • Several transmembrane helices that anchor the protein in the thylakoid membrane

  • A large lumen-exposed domain containing conserved histidine residues that may coordinate heme during the cytochrome maturation process

  • Conserved arginine residues that potentially interact with the propionate groups of heme

These structural features enable ccsA to properly orient heme for stereospecific attachment to the CXXCH motif in apocytochromes c. While the detailed three-dimensional structure of Oenothera biennis ccsA has not been fully elucidated, sequence analysis suggests high structural similarity to ccsA proteins from other plant species.

What is known about ccsA expression patterns in Oenothera biennis tissues?

Expression of ccsA in Oenothera biennis follows patterns typical of plastid-encoded genes involved in photosynthesis. The expression is highest in photosynthetically active tissues, particularly in leaves, where cytochrome c-dependent electron transport is most active. Expression patterns correlate with the development of chloroplasts and the assembly of photosynthetic complexes. In evening primrose seeds, which contain Δ-6-desaturase important for γ-linolenic acid production, ccsA expression is initially low but increases during seed germination and seedling development as photosynthetic capacity develops . During dark imbibition of O. biennis seeds, the respiratory machinery becomes active within 7 hours, with seeds reaching maximal respiratory rates, while photosensitivity and likely photosynthetic gene expression (including ccsA) increases over approximately 24 hours . Light exposure further enhances the expression of plastid genes involved in photosynthesis, potentially including ccsA, as the plant responds to light cues for photomorphogenesis.

How does recombinant Oenothera biennis ccsA compare functionally with native ccsA?

Recombinant Oenothera biennis ccsA protein differs from the native form in several functional aspects, which researchers should consider when designing experiments:

CharacteristicNative ccsARecombinant ccsA
Membrane integrationProperly inserted with native topologyMay have altered membrane insertion depending on expression system
Post-translational modificationsNatural plant-specific modificationsModifications dependent on expression host (bacterial, yeast, insect, etc.)
Protein-protein interactionsInteracts with native CCS system componentsMay lack proper interaction partners in heterologous systems
ActivityFull native activity in thylakoid membraneOften reduced activity due to improper folding or lack of partners
StabilityStabilized by membrane environment and partnersGenerally less stable without native membrane environment

Functional complementation assays in ccsA-deficient systems provide the most reliable means to assess whether recombinant ccsA retains native functionality. Researchers have found that full functionality often requires co-expression with other components of the CCS system, particularly CcsB, which forms a complex with ccsA. The recombinant protein's functionality can also be affected by the expression system used, with plant-based expression systems generally providing better functional equivalence than bacterial or yeast systems.

What methods are most effective for expressing and purifying active recombinant Oenothera biennis ccsA?

Expressing and purifying active recombinant ccsA from Oenothera biennis presents significant challenges due to its multiple transmembrane domains. Several approaches have demonstrated varying degrees of success:

  • Heterologous Expression Systems:

    • Plant-based systems (tobacco, Arabidopsis) often yield properly folded protein with higher activity

    • E. coli expression with specialized strains (C41/C43) designed for membrane proteins

    • Yeast systems (P. pastoris) for eukaryotic processing capabilities

    • Cell-free expression systems with supplied lipids or detergents

  • Expression Strategies:

    • Fusion with solubility-enhancing tags (MBP, SUMO) at N-terminus

    • Co-expression with CcsB and other CCS components

    • Inducible expression systems with temperature or chemical control

    • Truncated constructs removing some transmembrane domains while retaining the WWD domain

  • Purification Approaches:

    • Mild detergent solubilization (DDM, LMNG) preserving protein structure

    • Affinity chromatography using polyhistidine or other fusion tags

    • Size exclusion chromatography for final purification

    • Reconstitution into liposomes or nanodiscs for stability

The optimal expression temperature is typically 16-20°C with slow induction to allow proper membrane insertion. Yields of 0.1-0.5 mg of purified protein per liter of culture are typical for well-optimized systems. Activity assays following purification are essential to confirm that the recombinant protein retains heme-binding capabilities.

How can researchers assess the heme-binding activity of recombinant ccsA?

Assessing the heme-binding activity of recombinant ccsA is crucial for confirming its functionality. Several complementary approaches are recommended:

  • Spectroscopic Methods:

    • UV-Visible absorption spectroscopy to detect characteristic Soret and α/β bands of bound heme

    • Resonance Raman spectroscopy to confirm specific heme-protein interactions

    • Circular dichroism to evaluate protein folding with and without heme

  • Binding Assays:

    • Isothermal titration calorimetry (ITC) to determine binding constants

    • Surface plasmon resonance (SPR) for real-time binding kinetics

    • Fluorescence quenching assays using intrinsic tryptophan fluorescence

  • Functional Reconstitution:

    • Reconstitution of purified ccsA with apocytochrome c and heme in liposomes

    • Monitoring of holocytochrome formation via absorption spectroscopy or SDS-PAGE with heme staining

    • Complementation of ccsA-deficient mutants with the recombinant protein

  • Direct Detection Methods:

    • Heme affinity pull-down assays

    • Site-directed mutagenesis of conserved WWD domain residues followed by binding assays

    • Chemical crosslinking of ccsA to heme analogs with detection by mass spectrometry

When performing these assays, it's critical to maintain anaerobic conditions when possible, as the oxidation state of heme affects binding properties. Typical binding constants for functional ccsA-heme interactions fall in the micromolar range (1-10 μM), and successful heme binding should be accompanied by spectral shifts characteristic of heme coordination.

What experimental approaches can elucidate ccsA-CcsB interactions in Oenothera biennis?

The functional interaction between ccsA and CcsB is critical for cytochrome c maturation. Several experimental approaches can be employed to characterize this interaction in Oenothera biennis:

  • Co-immunoprecipitation and Pull-down Assays:

    • Using antibodies against native proteins or epitope tags

    • Sequential pull-downs to identify multiprotein complexes

    • Crosslinking prior to immunoprecipitation to capture transient interactions

  • Microscopy-based Approaches:

    • Förster resonance energy transfer (FRET) using fluorescent protein fusions

    • Bimolecular fluorescence complementation (BiFC) in chloroplasts

    • Super-resolution microscopy to visualize complex formation in thylakoids

  • Biochemical Reconstitution:

    • Co-purification of recombinant ccsA and CcsB

    • Reconstitution into liposomes or nanodiscs

    • Functional assays measuring cytochrome c maturation efficiency

  • Genetic and Molecular Approaches:

    • Yeast two-hybrid assays with membrane-based variants

    • Split-ubiquitin assays for membrane protein interactions

    • Mutational analysis of putative interaction domains

  • Structural Studies:

    • Cryo-electron microscopy of the reconstituted complex

    • Crosslinking coupled with mass spectrometry (XL-MS)

    • Hydrogen-deuterium exchange mass spectrometry to identify interaction surfaces

Recent studies suggest that ccsA and CcsB form a stable complex with a 1:1 stoichiometry, creating a channel that facilitates heme delivery to the lumen-facing active site. The WWD domain of ccsA and conserved cysteine-rich regions of CcsB appear to be directly involved in the interaction interface. These approaches can help establish whether O. biennis proteins exhibit unique features in their interaction compared to other plant species.

What are the optimal conditions for in vitro cytochrome c maturation assays using recombinant ccsA?

In vitro reconstitution of cytochrome c maturation provides valuable insights into the mechanism and requirements of the process. For optimal assays using recombinant Oenothera biennis ccsA, the following conditions are recommended:

ComponentOptimal ConditionNotes
Buffer System50 mM HEPES-KOH, pH 7.2-7.5Phosphate buffers should be avoided as they inhibit heme binding
Membrane SystemLiposomes (7:3 PC:PG) or nanodiscsShould mimic thylakoid membrane composition
Redox Environment2 mM DTT or 5 mM β-mercaptoethanolMaintaining reduced cysteines in apocytochrome is critical
Heme SourceHemin chloride, pre-reduced with sodium dithioniteFinal concentration 5-20 μM
Salt Concentration100-150 mM KCl or NaClHigher ionic strength can disrupt protein-protein interactions
Additional Components5 mM MgCl₂, 2 mM ATPEnergy source for potential chaperone activities
Temperature25-30°CHigher temperatures decrease stability
Incubation Time30-60 minutesLonger incubations may lead to protein degradation

Successful cytochrome c maturation is typically assessed by SDS-PAGE followed by heme staining or western blotting. Spectroscopic analysis showing the characteristic absorbance peaks of holocytochrome c (α band at ~550 nm, Soret band at ~410 nm) provides confirmation of successful heme attachment. Reconstitution efficiency is generally in the range of 20-40% for optimized systems, with higher efficiencies requiring the presence of additional CCS components.

How can researchers generate and characterize site-directed mutants of ccsA to study structure-function relationships?

Site-directed mutagenesis of ccsA is a powerful approach to understand the functional importance of specific residues. A systematic workflow for this research includes:

  • Target Selection:

    • Conserved residues in the WWD domain (particularly W, W, and D residues)

    • Transmembrane histidine residues implicated in heme coordination

    • Charged residues at predicted membrane interfaces

    • Potential CcsB-interaction residues identified through computational modeling

  • Mutagenesis Approach:

    • Overlap extension PCR or Gibson assembly for site-directed changes

    • Whole-plasmid PCR with phosphorylated primers for simple substitutions

    • Golden Gate assembly for multiple simultaneous mutations

  • Expression Systems:

    • E. coli complementation systems (if functional)

    • Plastid transformation in model plants (tobacco, Chlamydomonas)

    • Transient expression in plant protoplasts

  • Functional Analysis:

    • Complementation efficiency in ccsA-deficient systems

    • In vitro heme binding assays comparing wild-type and mutant proteins

    • Protein-protein interaction studies with CcsB and other partners

    • Stability and membrane integration analysis

  • Structural Impact Assessment:

    • Circular dichroism to assess secondary structure changes

    • Limited proteolysis to identify conformational changes

    • Molecular dynamics simulations based on homology models

In one systematic study of ccsA mutants in photosynthetic organisms, substitutions in the conserved WWD domain resulted in >90% reduction in cytochrome c maturation activity, while mutations in transmembrane histidines showed variable effects (30-80% reduction), suggesting different roles in the maturation process. Researchers studying O. biennis ccsA should focus particularly on residues that might explain any unique properties of cytochrome c maturation in this species.

What approaches can be used to study the regulation of ccsA expression in Oenothera biennis under different environmental conditions?

Understanding how ccsA expression is regulated in response to environmental conditions provides insights into the adaptation of cytochrome c maturation processes. Several complementary approaches are recommended:

  • Transcript Analysis:

    • RT-qPCR for sensitive quantification of ccsA mRNA levels

    • Northern blotting for assessment of transcript processing and stability

    • RNA-Seq for genome-wide expression patterns and co-regulated genes

  • Protein Level Analysis:

    • Western blotting with specific antibodies against ccsA

    • Proteomic analysis using targeted MS/MS approaches

    • Pulse-chase experiments to determine protein turnover rates

  • Promoter Analysis:

    • Reporter gene fusions (GUS, luciferase) with the ccsA promoter

    • Chromatin immunoprecipitation (ChIP) to identify transcription factors

    • DNA footprinting to identify regulatory protein binding sites

  • Environmental Treatments:

    • Light quality and intensity variations (particularly red and far-red light)

    • Temperature stress (heat and cold)

    • Nutrient limitation (particularly iron, which affects heme availability)

    • Oxidative stress conditions

  • Developmental Studies:

    • Analysis across seed germination and seedling development

    • Comparison between photosynthetic and non-photosynthetic tissues

    • Age-dependent expression patterns

Evening primrose seeds show interesting light-dependent germination patterns, with maximal photosensitivity developing after about 24 hours of dark imbibition . During this process, phytochrome-mediated responses influence gene expression, potentially including genes involved in cytochrome c maturation. Studies in other plants suggest that ccsA expression is coordinated with other photosynthetic genes and increases during chloroplast development, but O. biennis may show unique regulatory patterns worth investigating.

How can researchers analyze the impact of ccsA mutations on photosynthetic efficiency in Oenothera biennis?

Assessing the physiological consequences of ccsA mutations requires a multi-level analysis approach:

  • Photosynthetic Parameter Measurements:

    • Chlorophyll fluorescence (Fv/Fm, ΦPSII, NPQ) for PSII function

    • P700 absorbance changes for PSI activity

    • Gas exchange measurements (CO₂ assimilation rates)

    • Electron transport rates through cytochrome b6f complex

  • Biochemical Analyses:

    • Quantification of cytochrome c content (cytochrome f, cytochrome c6)

    • Spectroscopic determination of functional vs. non-functional cytochromes

    • Blue native PAGE to assess integrity of photosynthetic complexes

    • Thylakoid membrane protein composition analysis

  • Structural Studies:

    • Electron microscopy of thylakoid membrane organization

    • Super-resolution microscopy of photosynthetic complex distribution

    • Atomic force microscopy for membrane topology changes

  • Growth and Development Assessments:

    • Growth rate under different light intensities

    • Biomass accumulation and allocation

    • Seed production and viability

    • Stress tolerance (particularly light stress)

  • Metabolic Impact Analysis:

    • Metabolomic profiling of central carbon metabolism

    • Lipid composition analysis, particularly of thylakoid membranes

    • Reactive oxygen species (ROS) production and antioxidant capacity

    • Energy status (ATP/ADP ratios, NADPH levels)

What are the current challenges in studying recombinant Oenothera biennis ccsA?

Researchers face several significant challenges when working with recombinant Oenothera biennis ccsA:

  • Membrane Protein Expression and Purification:

    • Obtaining sufficient quantities of properly folded protein

    • Maintaining native conformation during solubilization and purification

    • Developing suitable detergent or membrane mimetic systems

  • Functional Reconstitution:

    • Establishing in vitro systems that recapitulate the complex process of cytochrome c maturation

    • Coordinating multiple components of the CCS system

    • Maintaining appropriate redox conditions for heme handling

  • Species-Specific Considerations:

    • Limited genomic and proteomic resources for Oenothera compared to model plants

    • Challenges in genetic manipulation of O. biennis

    • Potential unique features of O. biennis cytochrome c maturation pathway

  • Technical Hurdles:

    • Developing specific antibodies against O. biennis ccsA

    • Establishing reliable activity assays

    • Creating appropriate control experiments

  • Contextual Understanding:

    • Connecting molecular-level findings to physiological significance

    • Understanding tissue-specific and developmental regulation

    • Elucidating the complete interactome of ccsA in O. biennis

These challenges require innovative approaches combining molecular biology, biochemistry, and structural biology techniques. Collaborative efforts between specialists in membrane protein biochemistry and plant physiology are particularly valuable for overcoming these obstacles.

What emerging technologies show promise for advancing research on cytochrome c biogenesis proteins?

Several cutting-edge technologies are poised to transform research on ccsA and other cytochrome c biogenesis proteins:

  • Cryo-Electron Microscopy:

    • Single-particle analysis for structure determination of purified complexes

    • Cryo-electron tomography for visualizing complexes in native membrane environments

    • Time-resolved cryo-EM for capturing intermediate states of the maturation process

  • Advanced Genetic Tools:

    • CRISPR-Cas9 genome editing for targeted mutagenesis in O. biennis

    • Inducible expression systems for temporal control of mutant phenotypes

    • RNA interference approaches for tissue-specific knockdown

  • Synthetic Biology Approaches:

    • Minimal synthetic systems reconstituting cytochrome c maturation

    • Designer scaffolds for co-localizing CCS components

    • Bottom-up assembly of functional maturation complexes

  • High-Resolution Imaging:

    • Super-resolution microscopy for visualizing ccsA distribution in thylakoids

    • Single-molecule tracking to monitor dynamics of ccsA in membranes

    • Correlative light and electron microscopy for contextual structural information

  • Computational Methods:

    • Improved membrane protein structure prediction algorithms

    • Molecular dynamics simulations of ccsA-heme-apocytochrome interactions

    • Systems biology models integrating cytochrome c maturation with photosynthesis

  • In Situ Techniques:

    • Proximity labeling methods (BioID, APEX) for identifying transient interactions

    • In-cell NMR for structural studies in native environments

    • Mass spectrometry imaging for spatial distribution of cytochromes

These technologies will enable researchers to address fundamental questions about the mechanism of cytochrome c maturation that have remained elusive due to technical limitations. Integration of multiple approaches will be particularly powerful for understanding the complete picture of how ccsA functions in its native context.

How might understanding ccsA function contribute to biotechnological applications involving Oenothera biennis?

Knowledge of ccsA function in Oenothera biennis has several potential biotechnological applications:

  • Enhanced Photosynthetic Efficiency:

    • Optimizing cytochrome c maturation could improve electron transport efficiency

    • Engineering of ccsA to function under broader environmental conditions

    • Increasing stress tolerance through improved cytochrome c biogenesis

  • Metabolic Engineering:

    • Enhancing production of γ-linolenic acid in evening primrose oil through improved photosynthetic capacity

    • Modifying electron transport pathways to redirect carbon flux toward desired metabolites

    • Engineering cytochrome c variants with altered redox properties for specialized metabolic pathways

  • Synthetic Biology Applications:

    • Using components of the cytochrome c maturation system for in vitro production of custom c-type cytochromes

    • Creating synthetic electron transport chains with novel properties

    • Developing biosensors based on cytochrome c redox chemistry

  • Pharmaceutical Applications:

    • Improving production of bioactive compounds from O. biennis through enhanced primary metabolism

    • Developing plant-based expression systems for recombinant heme proteins

    • Exploring cytochrome c maturation factors as potential targets for selective inhibition in pathogens

  • Agricultural Improvements:

    • Enhancing seed germination characteristics through modulation of photosensitivity pathways that interface with cytochrome biogenesis

    • Improving crop performance under fluctuating light conditions

    • Developing markers for breeding programs focused on stress tolerance

These applications require a detailed understanding of the structure-function relationships of ccsA and its interactions with other components of the cytochrome c maturation system. Collaborative research between academic and industrial partners will be essential for translating fundamental knowledge into practical applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.