Recombinant Oenothera biennis NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for customers.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Oenothera biennis (German evening primrose) (Onagra biennis)
Target Names
ndhC
Target Protein Sequence
MFLLYEYDIFWAFLIISSVIPILAFRISGLLAPTSIGPEKLSSYESGIEPMGDAWLQFRI RYYMFALVFVVFDVETIFLYPWALSFDILGVSVFIEALIFVLILVLGLVYAWRKGALEWS
Uniprot No.

Target Background

Function

NDH shuttles electrons from NAD(P)H to plastoquinone, utilizing FMN and iron-sulfur (Fe-S) centers. This process facilitates electron transfer to quinones within the photosynthetic electron transport chain and potentially a chloroplast respiratory chain. In this species, plastoquinone is believed to be the enzyme's immediate electron acceptor. The enzyme couples this redox reaction to proton translocation, conserving redox energy within a proton gradient.

Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How does NAD(P)H-quinone oxidoreductase function biochemically?

NAD(P)H-quinone oxidoreductases catalyze the two-electron reduction of quinones and a wide variety of other organic compounds through a substituted enzyme (ping-pong) mechanism:

  • The enzyme's FAD cofactor is reduced by NAD(P)H

  • The oxidized cofactor (NAD(P)+) leaves the active site

  • The substrate (typically a quinone) enters the active site

  • The substrate is reduced by the FADH₂

This two-electron reduction mechanism is significant because it avoids the production of reactive semiquinones, thereby preventing oxidative stress. Unlike many enzymes that show specificity for either NADH or NADPH, quinone oxidoreductases can utilize both cofactors with similar efficiency .

What is the evolutionary significance of chloroplastic NAD(P)H-quinone oxidoreductase in plants?

While the search results don't directly address the evolutionary aspects of the Oenothera biennis protein, research on related quinone oxidoreductases suggests they play crucial roles in cellular protection. In plants, chloroplastic variants likely evolved to manage oxidative stress generated during photosynthesis. The ability to reduce quinones via a two-electron mechanism prevents the formation of reactive oxygen species that could damage photosynthetic machinery. This protective function would confer significant evolutionary advantages in high-light environments where oxidative stress is common.

What expression systems are most effective for producing recombinant Oenothera biennis NAD(P)H-quinone oxidoreductase?

For optimal expression of recombinant Oenothera biennis NAD(P)H-quinone oxidoreductase subunit 3, researchers should consider:

  • Expression host selection: E. coli BL21(DE3) or similar strains designed for recombinant protein expression

  • Vector design: Including appropriate chloroplast transit peptide sequences if studying the full-length protein

  • Expression conditions:

    • Induction at OD₆₀₀ of 0.6-0.8

    • Lower temperature expression (16-20°C) to improve protein folding

    • Supplementation with riboflavin or FAD in growth media to ensure proper cofactor incorporation

  • Purification tag selection: His-tag systems allow for efficient purification while maintaining enzymatic activity

When working with recombinant proteins that require FAD as a cofactor, co-expression with chaperones may improve proper folding and cofactor incorporation.

How can researchers accurately measure NAD(P)H-quinone oxidoreductase activity in vitro?

Several established methods can be used to measure NAD(P)H-quinone oxidoreductase activity:

  • Spectrophotometric assays:

    • Monitor NAD(P)H oxidation at 340 nm

    • The stoichiometry of oxygen consumption to NADH oxidation follows a 1:1 ratio

    • Hydrogen peroxide production can be monitored as a product

  • Superoxide scavenging activity:

    • Inhibition of dihydroethidium oxidation

    • Inhibition of pyrogallol auto-oxidation

    • Elimination of superoxide-generated adduct signals using electron spin resonance

  • Kinetic parameters:

    • Use xanthine/xanthine oxidase as a controlled source of superoxide

    • Measure NQO1-dependent NADH oxidation at 340 nm

    • Calculate reaction rates under varying substrate concentrations

What are the critical considerations for experimental design when studying enzyme inhibition?

When investigating inhibitors of NAD(P)H-quinone oxidoreductases, researchers should address these key considerations:

  • Inhibitor selection: Dicoumarol is a potent competitive inhibitor (Ki = 50 pM for rat enzyme; Kd = 120 nM for human enzyme)

  • Inhibition mechanism characterization:

    • Competitive vs. non-competitive inhibition

    • Reversible vs. irreversible inhibition

    • Single vs. multiple inhibition sites

  • Experimental controls:

    • Include 5-methoxy-1,2-dimethyl-3-[(4-nitrophenoxy)methyl]indole-4,7-dione (ES936) as a mechanism-based inhibitor control

    • Use enzyme-free and inhibitor-free controls

    • Include superoxide dismutase as a positive control for superoxide scavenging experiments

  • Lineweaver-Burk and Dixon plots: For determining inhibition constants and mechanisms

How does protein structure influence the catalytic mechanism of NAD(P)H-quinone oxidoreductases?

NAD(P)H-quinone oxidoreductases exhibit a sophisticated structure-function relationship:

  • Quaternary structure: These enzymes typically function as homodimers with two active sites formed at the interface between subunits

  • Active site composition:

    • Each active site comprises residues from both polypeptide chains

    • The FAD cofactor is an integral part of the active site

    • The NAD(P)H substrate binds with its nicotinamide ring parallel to FAD for efficient electron transfer

  • Protein mobility:

    • Correct protein mobility is essential for normal function

    • Inappropriate mobility results in dysfunction

    • Mobility likely mediates negative cooperativity between active sites

  • Structure-based inhibition: Compounds like dicoumarol act as competitive inhibitors by binding at the active site and preventing NAD(P)H binding

Understanding these structural elements provides insights into both the catalytic mechanism and potential approaches for modulating enzyme activity.

What is the role of NAD(P)H-quinone oxidoreductase in superoxide management?

Research demonstrates that NAD(P)H-quinone oxidoreductases play a significant role in superoxide (O₂⁻) scavenging:

  • Auto-oxidation kinetics:

    • Fully reduced enzyme undergoes auto-oxidation

    • This process is accelerated in the presence of superoxide

    • Superoxide dismutase inhibits this auto-oxidation

  • Experimental evidence for superoxide scavenging:

    • Addition of NQO1 with NAD(P)H inhibits dihydroethidium oxidation

    • It also inhibits pyrogallol auto-oxidation

    • It eliminates superoxide-generated adduct signals (detected by electron spin resonance)

  • Cellular significance:

    • Cell sonicates with high NQO1 activity show increased superoxide scavenging

    • This activity can be inhibited by ES936, a mechanism-based inhibitor

    • The enzyme may protect against superoxide at the site of hydroquinone generation

This superoxide scavenging function may be particularly important in chloroplasts, where reactive oxygen species are generated during photosynthesis.

How do post-translational modifications affect NAD(P)H-quinone oxidoreductase activity?

While the search results don't directly address post-translational modifications of the Oenothera biennis enzyme, studies of related quinone oxidoreductases suggest several potential mechanisms:

  • Phosphorylation: May alter enzyme activity by changing protein conformation or substrate binding affinity

  • Acetylation: Could affect protein stability and interactions with other cellular components

  • Redox-based modifications: The presence of cysteine residues suggests potential regulation through oxidation/reduction events

  • Cofactor binding: Changes in FAD binding affinity dramatically affect enzyme activity, as evidenced by the human p.P187S polymorphism which has reduced activity due to lower FAD affinity

Research on these modifications requires techniques such as mass spectrometry, phospho-specific antibodies, and site-directed mutagenesis to establish their functional significance.

What toxicological profiles have been established for Oenothera biennis extracts containing NAD(P)H-quinone oxidoreductase?

Toxicological studies on Oenothera biennis extracts have established the following safety profile:

  • Acute toxicity:

    • No mortalities or adverse effects observed in mice at doses up to 2000 mg/kg

    • General behavior remained normal after administration

  • Sub-acute toxicity (28-day study):

    • Daily oral administration at 200 and 400 mg/kg showed no mortality

    • No observable toxic effects were detected

    • Progressive increase in body weight was observed, suggesting improved nutritional state

  • Hematological parameters:

    • Most parameters remained within physiological range

    • White blood cell count showed a significant increase in the 200 mg/kg group and decrease in the 400 mg/kg group

    • This change in WBC may indicate immune system modulation

  • Biochemical parameters:

    • No significant changes in transaminases (GOT and GPT) and ALPs

    • No marked changes in creatinine, suggesting normal renal function

    • No significant changes in cholesterol levels

These findings suggest that Oenothera biennis extracts exhibit low toxicity under the studied conditions.

How do researchers establish safety protocols for working with recombinant quinone oxidoreductases?

When working with recombinant NAD(P)H-quinone oxidoreductases, researchers should implement the following safety protocols:

  • Risk assessment considerations:

    • Enzymatic activity may generate reactive oxygen species

    • Potential allergenicity of recombinant proteins

    • Toxicity of substrates and inhibitors (particularly dicoumarol derivatives)

  • Laboratory handling procedures:

    • Use of appropriate personal protective equipment

    • Implementation of containment measures for recombinant organisms

    • Proper waste disposal for enzyme reactions

  • Experimental design safety:

    • Include appropriate controls to monitor reactive oxygen species

    • Validate enzymatic activity under controlled conditions

    • Establish dose-response relationships for toxicity studies

  • Data monitoring and reporting:

    • Regular monitoring of key safety parameters

    • Documentation of any adverse effects or unexpected reactions

    • Transparent reporting of safety findings

What biochemical parameters should be monitored in toxicological studies of quinone oxidoreductase-related compounds?

Based on existing toxicological studies, the following parameters should be monitored:

In studies of Oenothera biennis extract, significant changes were observed in calcium, chloride, and blood urea nitrogen levels, suggesting these parameters may be particularly sensitive indicators of biological effects .

How should researchers analyze negative cooperativity in quinone oxidoreductases?

Negative cooperativity in quinone oxidoreductases presents unique analytical challenges:

  • Experimental approaches:

    • Substrate binding studies at varying concentrations

    • Hill plot analysis to determine cooperativity coefficient (n)

    • Scatchard plot analysis to visualize binding site interactions

  • Mechanistic investigation:

    • Protein mobility appears to mediate negative cooperativity

    • Structural analysis through X-ray crystallography or cryo-EM at different substrate concentrations

    • Site-directed mutagenesis to identify residues involved in cooperativity

  • Kinetic modeling:

    • Develop models incorporating negative cooperativity

    • Compare fitted parameters with experimental data

    • Use global fitting approaches for complex kinetic mechanisms

  • Data interpretation:

    • Distinguish between true negative cooperativity and apparent effects

    • Consider allosteric regulation mechanisms

    • Evaluate physiological significance of cooperativity in cellular context

What statistical approaches are most appropriate for analyzing enzyme kinetics data?

For robust analysis of NAD(P)H-quinone oxidoreductase kinetics, researchers should employ:

  • Nonlinear regression analysis:

    • Direct fitting to Michaelis-Menten or appropriate enzyme kinetics models

    • Avoid linearization methods (Lineweaver-Burk) for primary analysis due to error distortion

    • Use weighted fitting when error increases with substrate concentration

  • Model selection:

    • Compare simple vs. complex models (e.g., single-site vs. multiple-site binding)

    • Use Akaike Information Criterion (AIC) or F-test for model discrimination

    • Consider enzyme mechanisms when selecting kinetic models

  • Parameter estimation:

    • Report confidence intervals rather than just standard errors

    • Perform sensitivity analysis for key parameters

    • Consider bootstrap methods for robust parameter estimation

  • Experimental design optimization:

    • Use optimal design algorithms to select substrate concentrations

    • Ensure sufficient data points around Km

    • Include replicate measurements for error estimation

How can researchers interpret changes in enzyme activity across different experimental conditions?

When analyzing NAD(P)H-quinone oxidoreductase activity under various conditions, consider:

  • Normalization approaches:

    • Activity per unit protein

    • Activity relative to control conditions

    • Activity normalized to FAD content

  • Multivariate analysis:

    • Principal Component Analysis (PCA) to identify patterns across multiple parameters

    • Correlation analysis between enzyme activity and other measured variables

    • Multiple regression to identify key factors influencing activity

  • Validation strategies:

    • Cross-validation of findings across different experimental methods

    • Comparison of in vitro and cellular results

    • Verification through genetic approaches (e.g., overexpression, knockdown)

  • Interpretation framework:

    • Consider context-dependent effects (e.g., pH, temperature, ionic strength)

    • Evaluate physiological relevance of observed changes

    • Assess potential artifacts from experimental conditions

For example, when interpreting WBC changes in Oenothera biennis extract studies, researchers noted that "Increase in WBC may indicate the impact of Oenothera biennis in boosting the immune system" while also acknowledging that "slight changes in WBC did not show any dose responsiveness" , demonstrating the importance of considering both statistical significance and biological relevance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.