Recombinant Oenothera biennis NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic

What is the basic structure of Oenothera biennis NAD(P)H-quinone oxidoreductase subunit 4L?

Oenothera biennis NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic is a full-length protein consisting of 101 amino acids. The complete amino acid sequence is: MILEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNSVNLNFVTFSDFFDSRQLKGDIFSIFIIAIAAAEAAIGLAIVSSIYRNRKSIRINQSNLLNK . The protein is typically expressed with an N-terminal His-tag when produced in recombinant form, which facilitates purification and detection in experimental settings . The protein belongs to the broader family of NAD(P)H quinone oxidoreductases, which function as flavoenzymes containing tightly bound FAD cofactors essential for their catalytic activity .

What is the primary function of NAD(P)H-quinone oxidoreductase in plant systems?

NAD(P)H-quinone oxidoreductases catalyze the two-electron reduction of quinones and a wide variety of other organic compounds . In chloroplastic systems like those found in Oenothera biennis (evening primrose), these enzymes play crucial roles in:

• Reducing the free radical load in cells

• Detoxification of xenobiotics

• Electron transport in photosynthetic processes

• Protection against oxidative stress

The enzyme can function with almost equal efficiency using either NADH or NADPH as cofactors, which is unusual among oxidoreductases . This functional flexibility allows it to participate in diverse metabolic pathways within plant cells, particularly within chloroplasts where redox reactions are fundamental to energy production.

How does the catalytic mechanism of NAD(P)H-quinone oxidoreductase work?

NAD(P)H-quinone oxidoreductase operates via a substituted enzyme (ping-pong) mechanism involving several distinct steps:

• The tightly bound FAD cofactor is reduced by NAD(P)H

• The oxidized cofactor NAD(P)+ leaves the active site

• The second substrate (typically a quinone) enters the active site

• The substrate is reduced by FADH₂

• The reduced product (quinol) is released, and the enzyme returns to its original state

This two-electron reduction mechanism is particularly important as it avoids the production of reactive semiquinones, which can be highly damaging to cellular components . The enzyme's active sites are formed at the interface between subunits in the homodimeric structure, with each active site containing residues from both protein chains, creating a specialized environment for efficient catalysis .

What are the optimal conditions for expressing recombinant Oenothera biennis NAD(P)H-quinone oxidoreductase?

For optimal expression of recombinant Oenothera biennis NAD(P)H-quinone oxidoreductase subunit 4L, the following conditions and system have proven effective:

• Expression System: E. coli has been successfully used as an expression host

• Vector Design: Vectors containing an N-terminal His-tag facilitate purification

• Induction Parameters: Standard IPTG induction protocols for E. coli expression

• Purification Strategy: Immobilized metal affinity chromatography (IMAC) using the His-tag

• Quality Control: SDS-PAGE analysis should confirm >90% purity

The protein is typically obtained as a lyophilized powder after purification and can be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage, it is recommended to add 5-50% glycerol (final concentration) and store aliquots at -20°C/-80°C to maintain enzyme activity .

What methods are most effective for assessing NAD(P)H-quinone oxidoreductase activity in vitro?

Several robust methodologies can be employed to measure NAD(P)H-quinone oxidoreductase activity:

• Spectrophotometric Assays: Monitoring the decrease in absorbance at 340 nm corresponding to NAD(P)H oxidation

• Dicoumarol Inhibition: Using dicoumarol (a potent inhibitor with Ki = 50 pM) as a control to confirm specificity of enzyme activity

• Substrate Panel Testing: Examining activity with various quinones to determine substrate specificity profiles

• Coupled Enzyme Assays: For more sensitive detection of activity

• Kinetic Analysis: Determining Km and Vmax values for different substrates and cofactors

When conducting these assays, it's critical to control for non-enzymatic reduction of quinones by NAD(P)H, which can occur at significant rates. Additionally, the assay buffer composition, especially pH and ionic strength, can significantly impact measured activity levels .

How should researchers approach the storage and handling of recombinant NAD(P)H-quinone oxidoreductase to maintain activity?

To preserve enzymatic activity and structural integrity of recombinant NAD(P)H-quinone oxidoreductase:

• Storage Temperature: Store at -20°C/-80°C upon receipt

• Aliquoting: Divide into single-use aliquots to avoid repeated freeze-thaw cycles

• Reconstitution: Use deionized sterile water to reconstitute lyophilized protein

• Cryoprotectant: Add glycerol to a final concentration of 5-50% (optimally 50%) before freezing

• Working Storage: For short-term use, store working aliquots at 4°C for up to one week

• Buffer Conditions: Maintain in Tris/PBS-based buffer at pH 8.0 with 6% trehalose as a stabilizer

Before opening, briefly centrifuge vials to bring contents to the bottom. The enzyme's sensitivity to oxidation means that reducing agents might be beneficial in storage buffers, though care must be taken not to interfere with the enzyme's redox chemistry during subsequent experiments.

What is the relationship between azoreductases and NAD(P)H-quinone oxidoreductases, and how does this impact research approaches?

Recent research has revealed a previously unrecognized relationship between azoreductases and NAD(P)H-quinone oxidoreductases:

• Azoreductases from organisms like Pseudomonas aeruginosa can rapidly reduce quinones, suggesting functional overlap with NAD(P)H-quinone oxidoreductases

• Both enzyme families utilize similar reaction mechanisms involving flavin cofactors

• Sequence divergence among azoreductase family members is greater than previously recognized

• These enzymes likely form a broader FMN-dependent superfamily

This relationship has significant implications for research:

• When studying quinone metabolism, researchers should consider both traditional NAD(P)H-quinone oxidoreductases and azoreductases

• Inhibitor studies may need to account for cross-reactivity between these enzyme families

• Evolutionary analyses should consider the broader relationship between these enzyme groups

• The broad substrate specificity of these enzymes suggests they may play wider roles in cellular survival under adverse conditions than previously thought

How do structural variations in NAD(P)H-quinone oxidoreductase impact catalytic efficiency and substrate specificity?

The structure-function relationship in NAD(P)H-quinone oxidoreductases reveals several important considerations:

• Active Site Architecture: The enzyme functions as a homodimer with two active sites formed at the interface between subunits, with both active sites containing residues from both polypeptide chains

• Cofactor Binding: The FAD cofactor forms part of these active sites, with the NAD(P)H substrate binding such that the nicotinamide ring lies parallel to the FAD for efficient electron transfer

• Inhibitor Interactions: Compounds like dicoumarol bind in conformations that partially overlap the FAD cofactor, explaining their competitive inhibition with respect to NAD(P)H

• Protein Mobility: Evidence suggests that protein mobility plays a significant role in the enzyme's function, potentially mediating negative cooperativity observed in some quinone oxidoreductases

• Variant Effects: Specific variants, such as the p.P187S variant (NQO1*2) in human NQO1, show substantially reduced activity and stability, despite relatively minor structural changes visible in crystal structures

NMR studies indicate that structural mobility and susceptibility to unfolding can significantly impact enzyme function, even when crystal structures show minimal differences . This highlights the importance of using multiple structural and functional analysis techniques when studying these enzymes.

What are the implications of toxicity studies for research involving Oenothera biennis extracts containing NAD(P)H-quinone oxidoreductase?

Toxicity studies with Oenothera biennis extracts have revealed several important considerations for researchers:

• Acute Toxicity: No mortalities or adverse effects were observed in mice following acute oral administration at doses up to 2000 mg/kg of crude extracts

• Sub-acute Toxicity: Daily oral administration of methanol extract at doses of 200 and 400 mg/kg body weight for up to 28 days did not result in death or significant changes in body weight

• Hematological Effects: Most hematological parameters remained within physiological ranges throughout treatment periods, with only transient changes in white blood cell counts

• Biochemical Parameters: Changes in select biochemical parameters (Calcium, Chloride, blood urea nitrogen) suggest relatively low toxicity under study conditions

• Immune System Impact: Increases in WBC count may indicate potential immunomodulatory effects

These findings suggest that while Oenothera biennis extracts containing NAD(P)H-quinone oxidoreductase show low toxicity, researchers should still monitor specific parameters in experimental animals, particularly when conducting longer-term studies or using higher concentrations of extract .

How might NAD(P)H-quinone oxidoreductase from Oenothera biennis be utilized in biotechnological applications?

Based on the properties of NAD(P)H-quinone oxidoreductases and related enzymes, several promising biotechnological applications can be envisioned:

• Bioremediation: The ability to reduce a wide range of quinones and other organic compounds suggests potential applications in environmental detoxification of harmful chemicals

• Biosensors: The enzyme's activity with various substrates could be harnessed for developing sensors for quinone-based compounds

• Biocatalysis: The broad substrate specificity could be exploited for green chemistry applications in the synthesis of reduced quinones and related compounds

• Stress Resistance in Transgenic Plants: Overexpression might enhance plant resistance to oxidative stress and certain xenobiotics

• Pharmaceutical Applications: The enzyme's role in detoxification pathways suggests potential applications in drug metabolism studies or as a therapeutic target

The distinctive properties of the plant chloroplastic NAD(P)H-quinone oxidoreductase, particularly its ability to function with both NADH and NADPH, make it an interesting candidate for biotechnological exploitation compared to other members of this enzyme family .

What techniques can be used to study the in vivo role of NAD(P)H-quinone oxidoreductase in plant stress responses?

Advanced techniques for investigating the in vivo functions of NAD(P)H-quinone oxidoreductase in plant stress responses include:

• CRISPR/Cas9 Gene Editing: To create knockout or modified versions of the enzyme in model plant systems

• RNAi Approaches: For tissue-specific or inducible knockdown of enzyme expression

• Overexpression Studies: To determine effects of enhanced enzyme activity on stress tolerance

• Fluorescent Protein Tagging: To monitor subcellular localization and dynamics under different stress conditions

• Metabolomics: To identify changes in quinone and related metabolite profiles in response to stress

• Proteomics: To identify interaction partners and post-translational modifications under stress conditions

• Transcriptomics: To understand regulatory networks controlling enzyme expression

When designing these studies, researchers should consider the potential redundancy among quinone oxidoreductases and related enzymes, which may necessitate multiple gene targeting approaches to observe clear phenotypic effects.

How do variations in the gene encoding NAD(P)H-quinone oxidoreductase impact plant adaptation to different environmental conditions?

Research on variations in NAD(P)H-quinone oxidoreductase genes and their impact on environmental adaptation could explore:

• Natural Variation: Comparing enzyme sequences and activities across Oenothera biennis populations from different habitats

• Correlation with Stress Tolerance: Assessing whether specific variants correlate with enhanced tolerance to particular stressors (drought, heavy metals, pathogens)

• Evolutionary Analysis: Examining selection pressures on the gene across plant species

• Functional Characterization: Testing whether specific amino acid substitutions alter substrate specificity or catalytic efficiency

• Systems Biology Approaches: Integrating genomic, transcriptomic, and metabolomic data to understand how enzyme variants influence broader plant metabolic networks

Understanding these variations could provide insights into plant adaptation mechanisms and potentially inform breeding or genetic engineering strategies for enhanced stress tolerance in crops.

What are common challenges in purifying active recombinant NAD(P)H-quinone oxidoreductase and how can they be addressed?

Researchers frequently encounter several challenges when purifying recombinant NAD(P)H-quinone oxidoreductase:

• Maintaining Cofactor Association: The FAD cofactor is essential for activity but may dissociate during purification

  • Solution: Include FAD in purification buffers at low concentrations

• Protein Stability Issues: Some variants show reduced stability

  • Solution: Add stabilizing agents like trehalose (6%) to storage buffers

• Aggregation During Concentration: Protein may aggregate at higher concentrations

  • Solution: Use gentle concentration methods and avoid excessively high protein concentrations

• Activity Loss During Storage: Freeze-thaw cycles can reduce activity

  • Solution: Store in single-use aliquots with 50% glycerol at -80°C

• Expression as Inclusion Bodies: Sometimes the protein forms insoluble aggregates

  • Solution: Optimize induction conditions (lower temperature, reduced IPTG concentration) or use solubility-enhancing fusion tags

• Contaminating Activities: Other E. coli proteins may have overlapping activities

  • Solution: Include additional purification steps beyond IMAC, such as size exclusion chromatography

What considerations are important when designing inhibitor studies for NAD(P)H-quinone oxidoreductase?

When investigating inhibitors of NAD(P)H-quinone oxidoreductase, researchers should consider:

• Inhibitor Specificity: Many inhibitors like dicoumarol may affect multiple enzymes in the broader quinone oxidoreductase family

  • Recommendation: Test against related enzymes to confirm specificity

• Mechanism of Inhibition: Determine whether inhibition is competitive, uncompetitive, or noncompetitive with respect to both NAD(P)H and quinone substrates

  • Recommendation: Conduct thorough kinetic analyses with varying substrate and inhibitor concentrations

• Structure-Activity Relationships: Analyze how structural variations in inhibitors affect potency

  • Recommendation: Test series of structurally related compounds

• In Vitro vs. In Vivo Efficacy: Inhibitors that work well in purified enzyme systems may behave differently in cellular contexts

  • Recommendation: Validate findings in appropriate cellular models

• Physiological Relevance: Consider whether inhibition conditions reflect realistic biological scenarios

  • Recommendation: Use physiologically relevant pH, ionic strength, and substrate concentrations

Dicoumarol serves as an important reference inhibitor, with a Ki value of approximately 50 pM for rat NQO1 and a Kd value of 120 nM for human NQO1 as determined by isothermal titration calorimetry .

How does Oenothera biennis NAD(P)H-quinone oxidoreductase differ from similar enzymes in other species?

Comparison of Oenothera biennis NAD(P)H-quinone oxidoreductase with related enzymes reveals several notable differences:

• Subcellular Localization: The Oenothera biennis enzyme is specifically localized to chloroplasts, in contrast to cytosolic variants found in many other organisms

• Sequence Characteristics: The full 101-amino acid sequence contains distinctive features adapted to the chloroplastic environment

• Substrate Specificity: While maintaining the core NAD(P)H-quinone oxidoreductase activity, plant chloroplastic variants may show preferences for plastoquinones involved in photosynthetic electron transport

• Evolutionary Relationships: The enzyme belongs to a diverse family that includes azoreductases, with considerable sequence divergence among members

• Regulatory Mechanisms: Expression and activity regulation likely differs from mammalian counterparts like NQO1, reflecting different physiological roles

These differences highlight the importance of studying the specific properties of the Oenothera biennis enzyme rather than simply extrapolating from better-characterized homologs in other species.

What is the relationship between NAD(P)H-quinone oxidoreductase activity and plant secondary metabolism?

NAD(P)H-quinone oxidoreductase plays important roles in plant secondary metabolism through several mechanisms:

• Detoxification of Allelochemicals: Plants may use these enzymes to detoxify quinone-containing compounds produced by competing plants

• Phytochemical Synthesis: The enzyme may participate in redox reactions involved in the biosynthesis of certain secondary metabolites

• Stress Response Metabolism: Under stress conditions, NAD(P)H-quinone oxidoreductase may help regulate levels of redox-active secondary metabolites

• Interface with Primary Metabolism: The enzyme's ability to utilize both NADH and NADPH provides flexibility in connecting secondary metabolism with primary energy pathways

• Environmental Adaptation: Variations in enzyme activity or specificity may contribute to adaptation to different ecological niches where specific secondary metabolites are advantageous

Oenothera biennis (evening primrose) produces various bioactive compounds, and NAD(P)H-quinone oxidoreductase may be involved in their metabolism or in protecting the plant from their potentially toxic effects .

What are promising new approaches for studying the structure-function relationships of NAD(P)H-quinone oxidoreductase?

Emerging technologies offer new avenues for investigating structure-function relationships in NAD(P)H-quinone oxidoreductase:

• Cryo-Electron Microscopy: For high-resolution structural analysis of the enzyme under near-native conditions without crystallization

• Hydrogen-Deuterium Exchange Mass Spectrometry: To probe protein dynamics and conformational changes upon substrate or inhibitor binding

• Single-Molecule Enzymology: To detect potential heterogeneity in catalytic behavior and conformational states

• Computational Approaches:

  • Molecular dynamics simulations to understand protein flexibility

  • Quantum mechanics/molecular mechanics (QM/MM) calculations to model electron transfer mechanisms

  • Machine learning for predicting substrate specificity based on sequence information

• In-Cell NMR: To study the enzyme's behavior in a cellular environment

• Native Mass Spectrometry: To analyze cofactor binding, oligomerization, and interactions with other proteins

These approaches could provide deeper insights into how structural dynamics contribute to catalysis, particularly relevant given the evidence for negative cooperativity and the importance of protein mobility in quinone oxidoreductases .

How might climate change impact the expression and function of NAD(P)H-quinone oxidoreductase in plants like Oenothera biennis?

Climate change may affect NAD(P)H-quinone oxidoreductase in Oenothera biennis through several mechanisms:

• Temperature Effects:

  • Higher temperatures may alter protein stability and folding

  • Temperature stress could induce expression changes as part of heat shock responses

• Drought Impacts:

  • Water limitation increases oxidative stress, potentially elevating importance of detoxification enzymes

  • Altered cellular redox state may affect enzyme activity and substrate availability

• Elevated CO₂ Levels:

  • Changes in photosynthetic metabolism may alter electron flow through chloroplastic electron transport chains

  • This could change the demand for NAD(P)H-quinone oxidoreductase activity in managing quinone pools

• Increased UV Radiation:

  • Higher UV exposure generates more reactive oxygen species

  • May increase importance of detoxification pathways involving NAD(P)H-quinone oxidoreductase

• Altered Plant-Microbe Interactions:

  • Changes in pathogen pressure could affect expression of defense-related enzymes

  • NAD(P)H-quinone oxidoreductase may play roles in response to changing microbial communities

Research in this area could help predict plant adaptation to changing climates and inform strategies for crop improvement in the face of environmental challenges.

What are the most critical unresolved questions about NAD(P)H-quinone oxidoreductase in Oenothera biennis?

Despite significant advances in understanding NAD(P)H-quinone oxidoreductases, several critical questions remain specifically regarding the Oenothera biennis chloroplastic enzyme:

• What is the precise physiological role of this enzyme in chloroplast metabolism and plant stress responses?

• How does the enzyme's activity change in response to various environmental stressors relevant to the plant's ecology?

• What are its natural substrates in the chloroplast, and how does substrate specificity compare to related enzymes?

• What regulatory mechanisms control its expression and activity in different plant tissues and developmental stages?

• How does the enzyme interact with other components of chloroplastic electron transport chains?

• What structural features account for its ability to function with both NADH and NADPH cofactors?

• How has the enzyme evolved in the Oenothera genus, particularly in relation to the plant's adaptation to different environments?

Addressing these questions will require integrating molecular, biochemical, and physiological approaches, ideally combining in vitro studies of the recombinant enzyme with in vivo analyses in the plant itself.

What methodological advances would most benefit research on plant NAD(P)H-quinone oxidoreductases?

Future research on plant NAD(P)H-quinone oxidoreductases would benefit significantly from several methodological advances:

• Improved Enzyme Activity Assays:

  • Development of high-throughput methods to screen activity against diverse substrates

  • Creation of chloroplast-specific probes to monitor enzyme activity in vivo

• Enhanced Protein Engineering Approaches:

  • Methods for rapid production and screening of enzyme variants

  • Directed evolution techniques optimized for plant enzymes

• Advanced Imaging Techniques:

  • Super-resolution microscopy methods to visualize enzyme localization and dynamics in chloroplasts

  • Label-free imaging approaches to avoid interference with enzyme function

• Systems Biology Integration:

  • Multi-omics approaches to place the enzyme in broader metabolic networks

  • Mathematical modeling of redox metabolism incorporating NAD(P)H-quinone oxidoreductase activities

• Field-Based Phenotyping:

  • Non-destructive methods to assess enzyme activity in intact plants under natural conditions

  • Correlation of genetic variation with functional outcomes in diverse environments