Recombinant Oenothera biennis NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic

What is NAD(P)H-quinone oxidoreductase in Oenothera biennis?

NAD(P)H-quinone oxidoreductase is a chloroplastic protein found in Oenothera biennis (German evening primrose, also known as Onagra biennis). This protein is part of the electron transport chain in chloroplasts and exists in multiple subunits. The gene is commonly referred to as ndhE, with synonyms including NAD(P)H dehydrogenase subunit and NADH-plastoquinone oxidoreductase subunit .

What is the amino acid composition and structure of the NAD(P)H-quinone oxidoreductase subunit?

The full-length NAD(P)H-quinone oxidoreductase subunit 4L (which shares similar functions with subunit 6) consists of 101 amino acids with the sequence: "MILEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNSVNLNFVTFSDFFDSRQLKGDIFSIFIIAIAAAEAAIGLAIVSSIYRNRKSIRINQSNLLNK". This sequence reveals a protein with transmembrane domains characteristic of chloroplastic proteins involved in electron transport .

What expression systems are optimal for producing recombinant Oenothera biennis NAD(P)H-quinone oxidoreductase?

Based on established protocols, E. coli has proven to be an effective heterologous expression system for recombinant NAD(P)H-quinone oxidoreductase subunits. For optimal expression, the protein can be fused to an N-terminal His-tag, which facilitates subsequent purification steps. The recombinant protein expressed in E. coli maintains structural integrity comparable to the native protein when appropriate expression conditions are maintained .

What purification strategies yield the highest purity for recombinant NAD(P)H-quinone oxidoreductase?

The most effective purification approach involves affinity chromatography utilizing the His-tag, followed by additional purification steps if necessary. The purified protein can achieve greater than 90% purity as determined by SDS-PAGE analysis. During purification, maintaining appropriate buffer conditions is critical to preserve protein stability and activity .

What are the optimal storage conditions for preserving NAD(P)H-quinone oxidoreductase activity?

To maintain optimal enzyme activity, the purified protein should be stored as a lyophilized powder at -20°C/-80°C. For working solutions, reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of glycerol to a final concentration of 5-50% (with 50% being standard practice). Working aliquots can be stored at 4°C for up to one week, but repeated freeze-thaw cycles should be strictly avoided .

How can researchers differentiate between the various subunits of NAD(P)H-quinone oxidoreductase in Oenothera?

Researchers can employ PCR-based marker systems that have been developed specifically for the Oenothera genome. These molecular markers can distinguish between different plastid genes, including those encoding various subunits of NAD(P)H-quinone oxidoreductase. Such marker systems are particularly valuable when studying the genetic variation within and between Oenothera species .

What unique genetic features of Oenothera biennis impact the study of chloroplast proteins?

Oenothera biennis exhibits a phenomenon known as permanent translocation heterozygosity, where chromosomes form rings (⊙14) during meiosis rather than bivalent pairs. This unique genetic system prevents free segregation and homologous recombination between certain chromosomes. This arrangement has significant implications for studying chloroplast proteins like NAD(P)H-quinone oxidoreductase, as it affects the co-evolution of nuclear and plastid genomes .

How do the five basic plastome types in Oenothera differ regarding NAD(P)H-quinone oxidoreductase genes?

The five basic plastome types in Oenothera have been sequenced and analyzed, revealing variations in chloroplast genes, including those encoding NAD(P)H-quinone oxidoreductase subunits. These differences contribute to the distinct physiological characteristics observed among different Oenothera species and strains. Molecular marker systems can be employed to distinguish these plastome types in research settings .

How can NAD(P)H-quinone oxidoreductase be used to study plastid-nuclear co-evolution?

NAD(P)H-quinone oxidoreductase serves as an excellent model for studying plastid-nuclear co-evolution due to the unique genetic properties of Oenothera. The genus allows for the exchange of genetically definable plastids, individual chromosomes, and entire haploid genomes (Renner complexes) between species. By tracking changes in NAD(P)H-quinone oxidoreductase subunits across these genetic exchanges, researchers can gain insights into the co-evolutionary dynamics between the nuclear and plastid genomes .

What role might NAD(P)H-quinone oxidoreductase play in the biosynthesis of bioactive compounds in Oenothera biennis?

While direct evidence is limited, NAD(P)H-quinone oxidoreductase likely contributes indirectly to the biosynthesis of bioactive compounds found in Oenothera biennis. The plant contains significant amounts of fatty acids, phenolic acids, and flavonoids, particularly in its seeds, which produce the valuable evening primrose oil (EPO). By maintaining efficient electron transport in chloroplasts, NAD(P)H-quinone oxidoreductase supports the energy requirements for synthesizing these compounds .

How do mutations in NAD(P)H-quinone oxidoreductase genes affect photosynthetic efficiency in Oenothera?

Mutations in NAD(P)H-quinone oxidoreductase genes can significantly impact photosynthetic efficiency by altering electron flow within the chloroplast. Research involving molecular marker systems has demonstrated that specific variations in these genes correlate with differences in photosynthetic parameters. These variations may contribute to the adaptation of different Oenothera species to diverse environmental conditions .

How does the structure of NAD(P)H-quinone oxidoreductase in Oenothera compare to homologous proteins in other plant species?

Comparative analyses reveal that while the core functional domains of NAD(P)H-quinone oxidoreductase are conserved across plant species, Oenothera exhibits specific adaptations in certain subunits. The amino acid sequence of the Oenothera biennis NAD(P)H-quinone oxidoreductase subunit 4L (101 amino acids) shows specific structural features that may reflect adaptations to the plant's unique ecological niche .

What evolutionary pressures have shaped the NAD(P)H-quinone oxidoreductase complex in Oenothera?

The evolution of NAD(P)H-quinone oxidoreductase in Oenothera has been influenced by the genus's unique reproductive system, which includes complex chromosomal rearrangements and permanent translocation heterozygosity. These genetic features, combined with the plant's adaptation to diverse habitats across North and South America and later Europe, have likely contributed to the specific structural and functional characteristics of the NAD(P)H-quinone oxidoreductase complex .

How do the different Renner complexes in Oenothera affect NAD(P)H-quinone oxidoreductase expression?

In Oenothera biennis, Renner complexes (complete haploid chromosome sets) such as Gflavens and Galbicans in strain suaveolens Grado influence gene expression patterns, including those of chloroplast proteins like NAD(P)H-quinone oxidoreductase. The unique transmission of these complexes (e.g., Gflavens being inherited strictly maternally) creates distinct patterns of nuclear-plastid interactions that can affect the expression and function of chloroplastic proteins .

What are common challenges in expressing recombinant NAD(P)H-quinone oxidoreductase and how can they be overcome?

Common challenges include protein misfolding, formation of inclusion bodies, and low yields. These issues can be addressed by optimizing expression conditions (temperature, inducer concentration, expression duration), using specialized E. coli strains designed for membrane protein expression, and employing fusion tags that enhance solubility. For the His-tagged protein, careful optimization of imidazole concentrations during purification is essential to balance between purity and yield .

How can researchers validate the functional integrity of purified recombinant NAD(P)H-quinone oxidoreductase?

Functional validation can be performed through enzymatic activity assays measuring the rate of NAD(P)H oxidation or quinone reduction. Additionally, circular dichroism spectroscopy can assess secondary structure integrity, while thermal shift assays can evaluate protein stability. For membrane proteins like NAD(P)H-quinone oxidoreductase, reconstitution into liposomes or nanodiscs might be necessary to fully assess functional activity in a membrane environment.

What approaches can address stability issues with recombinant NAD(P)H-quinone oxidoreductase?

To address stability concerns, researchers should implement the following strategies: (1) Use a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 for storage; (2) Add glycerol to a final concentration of 50% for long-term storage; (3) Store aliquoted samples at -20°C/-80°C; (4) Avoid repeated freeze-thaw cycles; and (5) Use working aliquots stored at 4°C for no more than one week .

How might CRISPR-Cas9 technology enhance our understanding of NAD(P)H-quinone oxidoreductase function?

CRISPR-Cas9 technology offers promising avenues for creating specific mutations in NAD(P)H-quinone oxidoreductase genes to elucidate structure-function relationships. Building upon existing nuclear transformation protocols for Oenothera, CRISPR-based approaches could enable precise genetic manipulation to study the consequences of specific amino acid changes on protein function and plant physiology .

What potential biotechnological applications exist for recombinant NAD(P)H-quinone oxidoreductase?

Recombinant NAD(P)H-quinone oxidoreductase has potential applications in bioenergy research, particularly in enhancing photosynthetic efficiency and stress tolerance in crop plants. Understanding the structure and function of this protein complex from Oenothera biennis could inform strategies for engineering more efficient electron transport chains in photosynthetic organisms, potentially contributing to improved biomass production and stress resilience.

How might studies of NAD(P)H-quinone oxidoreductase contribute to understanding plant adaptation to environmental stresses?

As a component of the chloroplast electron transport chain, NAD(P)H-quinone oxidoreductase plays a role in plant responses to various environmental stresses, including high light, drought, and temperature extremes. Research into the specific adaptations of this complex in Oenothera biennis, which has successfully colonized diverse habitats, could provide insights into mechanisms of plant stress tolerance and inform strategies for improving crop resilience in changing climates.