Recombinant Oenothera biennis Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Biochemical Properties and Recombinant Production

The recombinant psbB protein is produced in Escherichia coli via heterologous expression systems. Key specifications include:

ParameterSpecificationSource
Gene NamepsbB
Protein LengthFull-length (1–508 amino acids)
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
Storage ConditionsLyophilized powder stored at -20°C/-80°C; avoid repeated freeze-thaw cycles
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL), with 5–50% glycerol for long-term storage

Amino Acid Sequence
The full-length sequence (508 residues) includes critical motifs for chlorophyll binding and interaction with PSII subunits. A partial sequence snippet:
MGLPWYRVHTVVLNDPGRLLAVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM... .

Functional Role in Photosystem II

CP47 (psbB) is essential for:

  • Chlorophyll Integration: Binds multiple chlorophyll a and b molecules, stabilizing the PSII core.

  • Reaction Center Assembly: Interacts with D1/D2 proteins and extrinsic subunits (e.g., PsbO, PsbU, PsbV) to form the oxygen-evolving complex (OEC) .

  • Light-Dependent Regulation: Modulates transcription under high-light (HL) conditions, as observed in Oenothera plastid incompatibility studies .

Key Interactions
In Oenothera hybrids, a 144 bp deletion upstream of the psbB operon reduces transcription under HL, disrupting PSII assembly and impairing oxygen evolution . This highlights psbB’s sensitivity to genetic and environmental stressors.

Plastid Incompatibility in Oenothera Hybrids

In incompatible AB-I hybrids, the psbB operon exhibits:

ParameterObservationSource
Transcript LevelsReduced accumulation of psbB, psbT, psbH, petB, petD under HL
Protein ImpactDownregulation of Pbf1 (photosystem biogenesis factor), exacerbating PSII defects
Cytb6f ComplexPartial loss of PetN subunit reduces Cytb6f accumulation, impairing electron transport

Biological Studies

  • PSII Assembly Models: Used to study how psbB interactions with D1/D2 and LMM subunits (e.g., PsbL, PsbM) drive PSII biogenesis .

  • Plastid Genetics: Serves as a model to investigate hybrid incompatibility and epistatic interactions in photosynthetic systems .

Challenges and Future Directions

  • Stability Optimization: Repeated freeze-thaw cycles degrade the protein, necessitating improved storage protocols .

  • Functional Studies: Further work is needed to elucidate psbB’s role in PSII repair cycles and redox regulation.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have specific format requirements, please specify them in your order. We will then prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for precise delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature and the inherent stability of the protein itself.
In general, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Oenothera biennis (German evening primrose) (Onagra biennis)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLAVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTVTNPGIWSYEGVAGSHILFSGLCFLAAIWHWVYWDL AIFSDERTGKPSLDLPKIFGIHLFLSGLACFGFGAFHVTGLYGPGIWVSDPYGLTGEVQP VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVGAGLAKNQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDSGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTIEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDTQVEFGAFQKLGDPTTRRQAV
Uniprot No.

Target Background

Function
CP47 is a key component of the core complex within Photosystem II (PSII). It binds chlorophyll and plays a critical role in catalyzing the primary light-induced photochemical reactions of PSII. PSII is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H₂O, producing O₂ and a proton gradient. This gradient is subsequently used for ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How does CP47 protein contribute to energy transfer in photosynthesis?

The CP47 protein functions as a light-harvesting antenna within Photosystem II, where it plays a central role in capturing and transferring excitation energy to the reaction center. The protein binds 16 chlorophyll molecules whose spatial arrangement and electronic coupling facilitate efficient excitation energy transfer .

The energy transfer process involves:

  • Light absorption by chlorophyll molecules within CP47

  • Creation of excitation energy (excitons)

  • Migration of excitation energy through the network of chlorophylls

  • Transfer to the reaction center where charge separation occurs

The site energies (excitation energies) of individual chlorophylls within CP47 are crucial determinants of the energy transfer pathways. Recent quantum chemical studies have identified that chlorophylls B3 and B1 are the most red-shifted within the complex, differing from previous hypotheses in the literature . This energy landscape creates an energy funnel that directs excitation toward the reaction center with remarkable efficiency.

The protein environment surrounding each chlorophyll molecule modulates its excitation energy through electrostatic interactions, thereby fine-tuning the energy transfer pathways. This sophisticated arrangement of chromophores enables plants to efficiently harvest light energy even under varying environmental conditions.

What expression systems are used for recombinant production of psbB protein?

Recombinant Oenothera biennis psbB protein can be successfully expressed in bacterial systems, with Escherichia coli being the most commonly used host . The protein production typically employs the following methodology:

  • Vector Selection: The full-length psbB gene (1-508 amino acids) is cloned into an expression vector containing an appropriate promoter (often T7) and a fusion tag (commonly His-tag) for purification purposes .

  • Expression Conditions: Transformation into E. coli expression strains (BL21(DE3) or derivatives) followed by induction with IPTG at optimized temperature, typically lower than 37°C to enhance proper folding of this membrane protein.

  • Protein Extraction and Purification: The recombinant protein is isolated using affinity chromatography (Ni-NTA for His-tagged proteins), followed by additional purification steps as needed .

  • Storage Conditions: The purified protein is often stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0. For long-term storage, addition of 5-50% glycerol and storage at -20°C/-80°C is recommended to maintain protein stability .

  • Quality Control: Purity assessment via SDS-PAGE (>90% purity standard) and functional characterization through spectroscopic methods to ensure the recombinant protein maintains native-like properties .

While E. coli is the predominant expression system, research applications requiring post-translational modifications or improved folding may necessitate eukaryotic expression systems, though these are less commonly employed for this particular protein.

How can quantum mechanics/molecular mechanics (QM/MM) approaches be applied to study CP47 function?

Quantum mechanics/molecular mechanics (QM/MM) approaches represent state-of-the-art computational methods for studying electronic properties of photosynthetic proteins like CP47. These approaches combine quantum mechanical calculations for the electronic structure of chromophores with molecular mechanics for the surrounding protein environment.

A multiscale QM/MM methodology applied to CP47 typically involves:

  • Model Preparation: Construction of a complete membrane-embedded photosystem II dimer model, including all protein subunits, cofactors, and a lipid bilayer to mimic the native environment .

  • QM Region Definition: The chlorophyll molecules of interest and potentially relevant coordinating residues are treated quantum mechanically using time-dependent density functional theory (TD-DFT) with range-separated functionals .

  • MM Region Treatment: The remainder of the protein complex and surrounding environment is modeled using molecular mechanics force fields.

  • Excitation Energy Calculations: The site energies of individual chlorophylls are computed using TD-DFT, accounting for the electrostatic effects of the protein environment on the chlorophyll electronic structure .

This approach has revealed that the electrostatic environment provided by the protein significantly influences the excitation energies of chlorophylls in CP47. For example, recent studies have identified chlorophylls B3 and B1 as the most red-shifted in the complex, challenging previous assignments in the literature . The QM/MM method provides a high-level quantum chemical excitation profile of CP47 within a computational model of "near-native" cyanobacterial PSII, offering unprecedented insights into the electronic structure of this light-harvesting complex.

What role does the clpP/psbB spacer region play in plastid-genome incompatibility in Oenothera?

The clpP/psbB spacer region has emerged as a critical determinant in plastid-genome incompatibility (PGI) in Oenothera species, particularly in hybrid plants. Research has revealed that this intergenic region can significantly influence the function of the adjacent psbB gene, which encodes the CP47 protein .

Key findings regarding the clpP/psbB spacer include:

  • Structural Variation: A deletion in the clpP/psbB spacer has been associated with the AB-I incompatibility phenotype in Oenothera hybrids, suggesting this region contains regulatory elements crucial for proper psbB expression .

  • Photosystem II Phenotype: Incompatible AB-I hybrids display a specific photosystem II deficiency, not notably affecting photosystem I, indicating selective disruption of PSII assembly or function .

  • Expression Analysis: Bioinformatic and phylogenetic analysis of the clpP/psbB spacer, combined with expression studies of psbB and clpP, have demonstrated that alterations in this region can affect transcript processing or stability .

  • Evolutionary Significance: The clpP/psbB spacer shows variation among different subplastomes in Oenothera populations, suggesting it may be a hotspot for evolutionary changes contributing to reproductive isolation .

This research highlights how non-coding regions can play crucial roles in speciation through their effects on gene expression and protein function. The clpP/psbB spacer represents a fascinating example of how subtle genomic changes can have profound effects on plant physiology and reproductive compatibility.

What spectroscopic methods are most effective for studying energy transfer within the CP47 complex?

Several spectroscopic techniques are particularly valuable for investigating energy transfer dynamics within the CP47 complex:

TechniqueInformation ProvidedTemporal ResolutionSample Requirements
Steady-state absorptionChlorophyll site energies, pigment orientationN/APurified protein or membrane preparations
Circular dichroismExciton coupling, pigment arrangementN/AHighly purified samples
Time-resolved fluorescenceEnergy transfer rates, lifetime of excited statesPicoseconds to nanosecondsDetergent-solubilized or membrane-embedded protein
Transient absorptionEnergy transfer pathways, excited state dynamicsFemtoseconds to nanosecondsHighly purified samples
Two-dimensional electronic spectroscopyElectronic coupling, energy transfer correlationsFemtosecondsUltra-pure samples, specialized equipment

The combination of these techniques provides complementary information about CP47 function:

  • Absorption and CD Spectroscopy: Identifies the spectral signatures of different chlorophyll molecules within the complex and their orientations relative to each other .

  • Time-Resolved Techniques: Tracks the movement of excitation energy through the chlorophyll network in real-time, revealing the kinetics and efficiency of energy transfer processes.

  • Two-Dimensional Electronic Spectroscopy: Provides detailed maps of electronic coupling between chlorophylls and visualizes energy flow pathways with exceptional temporal and spectral resolution.

Advanced spectroscopic studies have revealed that excitation energy transfer in CP47 occurs on multiple timescales, from femtoseconds to picoseconds, with the protein structure playing a crucial role in optimizing these processes for efficient light harvesting .

How does CP47 protein stability differ between isolated complexes and membrane-embedded environments?

The structural stability of CP47 proteins differs significantly between isolated complexes and their native membrane-embedded environments, with important implications for experimental design and data interpretation:

  • Structural Differences: Molecular dynamics simulations of isolated CP47 reveal which parts of the protein structure are most vulnerable to destabilization when removed from the native membrane environment . This information is crucial for researchers working with extracted samples.

  • Functional Consequences: The excitation energy profile of chlorophylls within CP47 can be altered when the protein is removed from its natural lipid environment, potentially leading to misinterpretation of spectroscopic data .

  • Experimental Considerations:

    • Isolated CP47 samples typically require detergent solubilization or reconstitution into artificial membrane systems

    • Native-like conditions may be better maintained using nanodiscs or styrene maleic acid lipid particles (SMALPs)

    • Temperature, pH, and ionic strength must be carefully controlled to maintain protein integrity

  • Validation Approaches: Researchers should consider complementary in vitro and in silico approaches to confirm findings:

    • Comparing spectroscopic data from isolated complexes with membrane-embedded samples

    • Using molecular dynamics simulations to predict and interpret structural changes

    • Employing native mass spectrometry to assess complex integrity

This understanding highlights the importance of experimental context when studying photosynthetic proteins and suggests that computational models incorporating the complete membrane environment may provide more accurate insights into CP47 function than studies of isolated complexes alone .

What methodologies are most effective for investigating the role of psbB in plastid-genome incompatibility?

Investigating the role of psbB in plastid-genome incompatibility (PGI) requires a multidisciplinary approach combining genetic, molecular, and physiological methodologies:

  • Generation of Interspecific Hybrids: Creating specific plastome-genome hybrid combinations (e.g., AB-I, AB-III, BB-II) through controlled crossing experiments to study incompatibility phenotypes .

  • Marker Systems for Genetic Analysis:

    • Co-dominant markers discriminating A and B genomes

    • Genotyping of Renner complexes

    • Markers for basic plastomes and subplastomes

  • Photosynthetic Phenotyping:

    • Chlorophyll fluorescence analysis to assess PSII function

    • 77K fluorescence spectroscopy to distinguish PSI and PSII effects

    • Western blot analysis of thylakoid membrane proteins

  • Molecular Characterization:

    • Expression analysis of psbB and adjacent genes using quantitative RT-PCR

    • Investigation of the clpP/psbB spacer region across different subplastomes

    • Bioinformatic and phylogenetic analysis of the intergenic region

  • Functional Complementation: Transformation of incompatible hybrids with constructs containing wild-type psbB and various versions of the clpP/psbB spacer to determine which elements restore compatibility.

This integrated approach has revealed that the AB-I incompatibility in Oenothera is associated with a specific photosystem II phenotype linked to alterations in the clpP/psbB spacer region . The effects are selective, primarily affecting PSII without notable impact on PSI. Western analysis of thylakoid membranes and detailed expression studies of psbB have provided critical insights into the molecular mechanisms underlying this incompatibility.

How can the study of CP47 in Oenothera contribute to understanding photosynthetic evolution?

The study of CP47 in Oenothera provides unique insights into photosynthetic evolution due to several factors:

  • Evolutionary Time Frame: The five basic plastomes in Oenothera diverged relatively recently, allowing researchers to study early stages of chloroplast genome evolution. Molecular clock analyses suggest divergence times that provide a window into recent evolutionary processes affecting photosynthetic apparatus .

  • Natural Variation: The documented variations in the clpP/psbB spacer region among Oenothera subplastomes represent natural experiments in the evolution of gene regulation, offering insights into how non-coding regions influence protein expression and function .

  • Selection Pressures: Analysis of Ka/Ks values (ratio of non-synonymous to synonymous substitutions) for psbB and other photosynthetic genes in Oenothera provides evidence of selection pressures acting on the plastome . This information helps identify which components of the photosynthetic apparatus are under purifying selection versus those undergoing adaptive evolution.

  • Speciation Model: Oenothera serves as a unique model to study the role of plastids in speciation. The compatibility and incompatibility relationships between different plastome-genome combinations illuminate how photosynthetic function can contribute to reproductive isolation .

  • Comparative Genomics: Schematic overviews of the clpP/psbB spacer region in Oenothera compared to other species like Spinacea and Nicotiana reveal evolutionary patterns in intergenic regions that affect photosynthetic gene expression .

This research provides valuable perspectives on how photosynthetic apparatus evolves at both coding and regulatory levels, contributing to our broader understanding of chloroplast genome evolution and its role in plant speciation.

What are the challenges in purifying functional recombinant CP47 protein for structural studies?

Purifying functional recombinant CP47 protein presents several significant challenges for structural studies:

  • Membrane Protein Complexity: As an integral membrane protein, CP47 contains hydrophobic regions that make it difficult to express and purify in a functional state. Specialized detergents or membrane mimetics are required to maintain protein stability during purification .

  • Chlorophyll Integration: Native CP47 binds 16 chlorophyll molecules essential for its function. Recombinant expression systems often lack the machinery to properly incorporate these pigments, necessitating reconstitution strategies .

  • Expression Host Limitations:

    • Bacterial hosts like E. coli lack chlorophyll and the complex photosynthetic machinery

    • Plant-based expression systems may offer better pigment incorporation but lower yields

    • Cell-free systems may be advantageous but are technically challenging

  • Purification Strategy Optimization:

    • Buffer composition (Tris/PBS-based buffers with stabilizing agents like trehalose)

    • Temperature control during extraction and purification

    • Prevention of aggregation using appropriate detergents

    • Storage conditions (-20°C/-80°C with 5-50% glycerol)

  • Functional Verification: Confirming that the purified recombinant protein retains native-like properties requires specialized spectroscopic analyses to assess chlorophyll binding and energy transfer capabilities.

Researchers have addressed these challenges through careful optimization of expression conditions and the development of specialized purification protocols. Current best practices include expressing the protein with affinity tags (such as His-tags), purifying under mild conditions to maintain structural integrity, and reconstituting with chlorophyll when necessary . The storage buffer typically includes Tris/PBS with 6% trehalose at pH 8.0, with recommendations to avoid repeated freeze-thaw cycles .

How can site-directed mutagenesis be used to study CP47 structure-function relationships?

Site-directed mutagenesis offers a powerful approach to investigate CP47 structure-function relationships, providing mechanistic insights into its role in photosynthesis:

  • Strategic Target Selection:

    • Chlorophyll-binding residues: Typically histidines, glutamines, or asparagines that coordinate chlorophyll molecules

    • Residues in the vicinity of red-shifted chlorophylls (B3 and B1) to investigate their spectral properties

    • Amino acids in the clpP/psbB spacer region that may affect expression or function

    • Conserved residues identified through multiple sequence alignments across species

  • Experimental Design Considerations:

    • Single vs. multiple mutations to assess cumulative effects

    • Conservative substitutions to test specific interactions

    • Creation of chimeric proteins combining sequences from compatible and incompatible species

  • Functional Assays:

    • Spectroscopic analysis to measure changes in chlorophyll binding and excitation energy transfer

    • Chlorophyll fluorescence to assess PSII assembly and function

    • Protein-protein interaction studies to examine associations with other PSII components

  • Expression Systems:

    • Homologous recombination in cyanobacteria for in vivo studies

    • E. coli expression for in vitro biochemical and biophysical characterization

    • Chloroplast transformation in model plants for physiological studies

This approach has revealed that specific amino acid residues create the protein environment that tunes chlorophyll excitation energies, particularly for the most red-shifted chlorophylls that drive the energy transfer process . By systematically altering these residues, researchers can map the electrostatic landscape that shapes the energy transfer pathways within CP47 and understand how structural modifications in this protein contribute to plastid-genome incompatibility in Oenothera hybrids .

What computational tools are most effective for predicting chlorophyll binding sites in CP47?

Predicting chlorophyll binding sites in CP47 requires specialized computational tools that can accurately model the interactions between the protein and these complex pigment molecules:

  • Homology Modeling and Threading Approaches:

    • Phyre2 and I-TASSER for initial protein structure prediction

    • Specialized refinement of chlorophyll-binding pockets

    • Validation against experimental structures from related species

  • Molecular Docking Methods:

    • AutoDock and HADDOCK adapted for chlorophyll-protein interactions

    • Scoring functions that account for π-stacking and coordination chemistry

    • Ensemble docking to accommodate protein flexibility

  • Molecular Dynamics Simulations:

    • GROMACS or NAMD with specialized force fields for chlorophyll parameters

    • Long timescale simulations (>100 ns) to capture binding site dynamics

    • Analysis of hydrogen bonding networks and water-mediated interactions

  • Quantum Mechanical Calculations:

    • Density Functional Theory (DFT) to optimize chlorophyll-protein interactions

    • QM/MM approaches that combine quantum mechanics for the binding site with molecular mechanics for the protein environment

    • Time-dependent DFT with range-separated functionals to compute excitation energies

  • Machine Learning Applications:

    • Neural networks trained on known chlorophyll-binding proteins

    • Feature extraction from sequence and structural data

    • Integration with evolutionary conservation analysis

These computational approaches have revealed that the protein environment surrounding chlorophyll molecules in CP47 significantly modulates their excitation energies through electrostatic interactions . The most effective predictions come from combining multiple approaches, particularly when incorporating experimental constraints from spectroscopic data.

How can researchers address expression and stability issues with recombinant psbB protein?

Researchers encountering expression and stability challenges with recombinant psbB protein can implement several strategic approaches:

  • Optimization of Expression Conditions:

    • Reduce expression temperature (16-20°C) to slow protein synthesis and improve folding

    • Test multiple E. coli strains specialized for membrane protein expression (C41(DE3), C43(DE3), Lemo21(DE3))

    • Optimize induction parameters (IPTG concentration, induction time)

    • Consider co-expression with molecular chaperones (GroEL/GroES, DnaK/DnaJ)

  • Protein Engineering Strategies:

    • Fusion partners to enhance solubility (MBP, SUMO, Trx)

    • Truncation constructs to remove problematic regions while maintaining core function

    • Surface entropy reduction to improve crystallization properties

    • Codon optimization for the expression host

  • Buffer Optimization:

    • Incorporate stabilizing agents (trehalose, glycerol) in purification buffers

    • Systematically test pH ranges (typically pH 7.5-8.5)

    • Evaluate different detergents (DDM, LDAO, C12E8) for membrane protein solubilization

    • Include protease inhibitors to prevent degradation

  • Storage and Handling:

    • Avoid repeated freeze-thaw cycles

    • Aliquot purified protein and store at -80°C for long-term stability

    • For working stocks, maintain at 4°C for up to one week

    • Add 5-50% glycerol for cryoprotection

  • Quality Control Metrics:

    • Assess protein homogeneity by size-exclusion chromatography

    • Verify secondary structure integrity using circular dichroism

    • Confirm chlorophyll binding through absorbance spectroscopy

    • Validate function using energy transfer assays

These approaches address the inherent challenges of working with this complex membrane protein. Successful expression typically yields protein with greater than 90% purity as determined by SDS-PAGE, stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0 . The optimal reconstitution protocol involves carefully rehydrating lyophilized protein to a concentration of 0.1-1.0 mg/mL in deionized sterile water before use .

What are the best approaches for studying CP47-chlorophyll interactions in vitro?

Studying CP47-chlorophyll interactions in vitro requires specialized approaches to maintain the native-like environment critical for proper pigment-protein interactions:

  • Reconstitution Strategies:

    • Detergent-mediated reconstitution: Controlled addition of chlorophylls to detergent-solubilized protein

    • Liposome incorporation: Integration of protein-pigment complexes into artificial membrane vesicles

    • Nanodiscs: Embedding CP47 in disc-shaped lipid bilayers stabilized by scaffold proteins

  • Spectroscopic Analysis Suite:

    • Absorption spectroscopy: Baseline characterization of chlorophyll binding

    • Fluorescence spectroscopy: Energy transfer efficiency assessment

    • Circular dichroism: Evaluation of pigment-protein structural relationships

    • Resonance Raman spectroscopy: Vibrational analysis of chlorophyll-protein interactions

  • Binding Affinity Determination:

    • Isothermal titration calorimetry (ITC): Thermodynamic parameters of chlorophyll binding

    • Microscale thermophoresis (MST): Binding affinity measurements in solution

    • Surface plasmon resonance (SPR): Real-time binding kinetics

  • Structural Characterization:

    • Cryo-electron microscopy: High-resolution structural analysis of the intact complex

    • Cross-linking mass spectrometry: Identification of specific interaction sites

    • Hydrogen-deuterium exchange: Mapping binding-induced conformational changes

  • Environmental Control Factors:

    • Lipid composition: Mimicking native thylakoid membrane environment

    • Redox conditions: Maintaining appropriate oxidation states for cofactors

    • Light exposure management: Preventing photooxidative damage during experiments

These methodologies have revealed that the excitation energies and electronic coupling of chlorophylls within CP47 are finely tuned by their protein environment. Recent studies using high-level quantum chemical calculations have identified chlorophylls B3 and B1 as the most red-shifted in the complex, challenging previous assignments and providing new insights into energy transfer pathways .

How might CP47 research contribute to synthetic photosynthesis applications?

Research on CP47 from Oenothera biennis has significant potential to inform and advance synthetic photosynthesis applications through several promising avenues:

  • Bio-inspired Light-harvesting Design:

    • The spatial arrangement of chlorophylls in CP47 provides a blueprint for designing artificial antenna systems with optimized energy transfer properties

    • Understanding how the protein environment tunes chlorophyll excitation energies can inform the development of synthetic scaffolds that achieve similar effects

    • The identification of red-shifted chlorophylls (B3 and B1) suggests strategic positioning of chromophores for efficient energy funneling

  • Protein Engineering Applications:

    • Creation of chimeric proteins combining the robust structural features of CP47 with enhanced functional properties

    • Modification of chlorophyll-binding sites to accommodate synthetic chromophores with desired spectral properties

    • Engineering increased stability under non-native conditions for technological applications

  • Cross-species Comparative Analysis:

    • Insights from Oenothera CP47 can be compared with orthologs from extremophile organisms to identify adaptations for harsh environments

    • Variation in the clpP/psbB spacer region offers lessons in the regulation of photosynthetic protein expression

    • Evolutionary patterns in CP47 sequence conservation highlight functionally critical regions for biomimetic design

  • Biomolecular Interface Development:

    • CP47's interaction with other PSII components provides models for designing multi-component photosynthetic assemblies

    • Integration of recombinant CP47 into artificial membranes or electrode surfaces for bio-hybrid solar energy conversion

    • Creation of standardized test systems for evaluating energy transfer efficiency in artificial photosynthetic constructs

These research directions illustrate how fundamental studies of a natural light-harvesting protein can drive innovations in artificial photosynthesis, potentially contributing to the development of more efficient solar energy conversion technologies inspired by nature's time-tested designs.

What emerging technologies might enhance our understanding of CP47 function in vivo?

Several emerging technologies show promise for advancing our understanding of CP47 function in its native cellular environment:

  • Advanced Imaging Techniques:

    • Super-resolution microscopy (STORM, PALM): Visualization of CP47 organization within thylakoid membranes at nanometer resolution

    • Cryo-electron tomography: 3D structural analysis of CP47 in intact chloroplasts

    • Correlative light and electron microscopy (CLEM): Linking functional and structural data at the subcellular level

  • In vivo Spectroscopy Innovations:

    • Single-molecule spectroscopy in live cells: Probing energy transfer dynamics in individual CP47 complexes

    • Ultrafast transient absorption microscopy: Tracking excitation energy flow with high temporal and spatial resolution

    • Non-linear optical techniques: Investigating electronic coherence in photosynthetic energy transfer

  • Genetic and Molecular Tools:

    • CRISPR-Cas9 genome editing: Precise modification of the psbB gene and surrounding regulatory regions

    • Optogenetic approaches: Light-controlled regulation of CP47 expression or assembly

    • Genetically encoded sensors: Real-time monitoring of energy transfer processes in living cells

  • Computational Advancements:

    • Quantum-classical hybrid modeling: Improved simulation of quantum coherence effects in energy transfer

    • Machine learning approaches: Identification of subtle structure-function relationships from large datasets

    • Whole-cell models: Integration of CP47 function into comprehensive simulations of photosynthetic performance

  • Multi-omics Integration:

    • Connecting transcriptomics, proteomics, and metabolomics data to understand system-level responses to CP47 modifications

    • Spatial transcriptomics/proteomics: Mapping CP47 expression and interaction networks within cellular compartments

    • Comparative multi-omics across Oenothera species: Identifying regulatory networks governing plastid-nuclear compatibility

These technological frontiers promise to reveal new aspects of CP47 function beyond what can be achieved with traditional biochemical approaches, particularly in understanding how this protein operates within the complex milieu of the living cell and how its function is integrated into the broader physiological context of plant photosynthesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.