Recombinant Oenothera biennis Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant protein is produced via heterologous expression in E. coli, followed by purification. Critical steps include:

StepDetailsSource
Expression HostE. coli
Storage BufferTris-based buffer with 50% glycerol, pH 8.0
ReconstitutionRecommended in deionized sterile water (0.1–1.0 mg/mL), with glycerol for stability
StabilityAvoid repeated freeze-thaw cycles; store at -20°C/-80°C

Notable Considerations:

  • The absence of a specified tag distinguishes this preparation from His-tagged variants in other Oenothera species (e.g., glazioviana, argillicola) .

  • Glycerol addition (5–50%) is critical for long-term storage and functional integrity .

Role in Photosystem II

The D1 protein (PSII Q(B)) is integral to PSII’s core heterodimer (D1-D2), facilitating:

  • Electron Transfer: Mediation of electron flow from pheophytin to plastoquinone (QA_A → QB_B) .

  • Quinone Binding: Structural motifs in the D-E loop stabilize QB_B, enabling protonation and release .

  • Assembly and Repair: Interactions with auxiliary factors (e.g., Psb27, Psb28) during PSII biogenesis .

Applications in Research

ApplicationDetailsSource
ELISA StudiesUsed as antigen for antibody production or immunological assays
Structural BiologyModel for studying QB_B binding dynamics and PSII assembly intermediates
Chloroplast-Nuclear InteractionsInvestigating hybrid incompatibility in Oenothera species (e.g., psbA-linked loci)

Key Findings:

  • QB_B Binding Site Modulation: Psb28 binding induces conformational changes in the D1 D-E loop, altering QB_B accessibility .

  • Chloroplast-Nuclear Incompatibility: psbA polymorphisms may influence hybrid viability in Oenothera species, though psbM/petN regions show minor contributions .

Mechanistic Insights

  • Assembly Factors: Psb27 and Psb34 stabilize immature PSII complexes, replacing bicarbonate ligands at the non-haem iron site to protect against photodamage .

  • Lipid Biosynthesis: accD (acetyl-CoA carboxylase) polymorphisms correlate with chloroplast inheritance strength, potentially linking lipid metabolism to PSII function .

Future Directions

  • Structural Studies: Cryo-EM of Oenothera biennis PSII complexes to elucidate species-specific assembly mechanisms.

  • Evolutionary Genetics: Mapping psbA polymorphisms in hybrid zones to understand chloroplast-nuclear coevolution .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your preferences when placing your order, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is advisable to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize the development of the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Oenothera biennis (German evening primrose) (Onagra biennis)
Target Names
psbA
Target Protein Sequence
MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex responsible for photon capture and an electron transfer chain that converts photonic excitation into a charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Photosystem Q(B) protein in Oenothera biennis and what is its biological function?

Photosystem Q(B) protein, also known as the PSII D1 protein or psbA, is a critical component of Photosystem II in the photosynthetic apparatus of Oenothera biennis (evening primrose). This protein is essential for light-dependent reactions in photosynthesis, specifically electron transport. The D1 protein forms part of the reaction center in PSII where it binds to electron acceptors and participates in water-splitting reactions. In the photosynthetic electron transport chain, the Q(B) protein serves as the binding site for plastoquinone B, facilitating electron transfer from the primary quinone acceptor (QA) to the plastoquinone pool .

Functionally, the protein plays a crucial role in maintaining efficient photosynthetic activity and is particularly important under varying environmental conditions, including calcium or chloride depletion, as observed in studies of homologous proteins in cyanobacterial systems .

What are the optimal storage and reconstitution protocols for recombinant Oenothera Photosystem Q(B) protein?

For optimal results when working with recombinant Oenothera Photosystem Q(B) protein, researchers should follow these storage and reconstitution protocols:

Storage Protocol:

  • Store the lyophilized protein at -20°C to -80°C upon receipt

  • For long-term storage, add glycerol to a final concentration of 5-50% (with 50% being optimal for most applications)

  • Aliquot the protein solution to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • Avoid repeated freezing and thawing as this significantly reduces protein activity

Reconstitution Protocol:

  • Briefly centrifuge the vial before opening to ensure all content is at the bottom

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • The protein is typically provided in a Tris/PBS-based buffer with 6% trehalose at pH 8.0, which helps maintain stability

  • After reconstitution, aliquot the protein and add glycerol for long-term storage

These protocols maintain protein integrity and activity, which is critical for downstream applications and experimental reproducibility.

How can histidine-tagged PsbQ variants be used for isolation of functional photosystem complexes?

Histidine-tagged PsbQ variants represent a powerful approach for isolating intact and functional photosystem complexes. Based on research with cyanobacterial systems, the following methodology has proven effective:

  • Design of His-tagged constructs: Generate a construct with a C-terminal polyhistidine tag (typically octa-histidine) while ensuring the native promoter remains intact. This approach is particularly effective because the C-terminus of PsbQ is positioned away from the face that interacts with Photosystem II, minimizing functional interference .

  • Verification of functionality: Before proceeding with isolation, verify that the His-tagged variant retains normal function by comparing:

    • Photoautotrophic growth rates

    • Oxygen evolution activity under standard and calcium-deficient conditions

    • Protein-protein interactions within the photosystem complex

  • Isolation procedure: Use affinity chromatography with Ni-NTA resin to isolate the PsbQ-tagged photosystem complexes. This approach offers a significant advantage over traditional methods as it selectively enriches for fully assembled, functionally active complexes rather than partially assembled intermediates .

Research has demonstrated that PsbQ-tagged PSII complexes isolated through this method exhibit higher rates of oxygen evolution compared to complexes isolated through other methods (such as CP47-tagged PSII), indicating enhanced functional quality of the isolated material .

How do PsbQ-associated photosystem complexes differ from other PSII populations, and what are the implications for research?

PsbQ-associated photosystem complexes represent a distinct subpopulation of PSII complexes with several important characteristics that differentiate them from the broader PSII population:

Research implications:

  • Studies requiring highly active PSII should prioritize PsbQ-tagged isolation methods

  • When investigating PSII assembly or maturation, researchers should consider that different isolation methods may select for different subpopulations

  • Understanding the specific conditions promoting PsbQ association could provide insights into optimizing photosynthetic efficiency

This distinction between PSII subpopulations has significant implications for experimental design, particularly when functional assays or structural studies are planned.

What evolutionary patterns exist in photosystem gene families across Oenothera species?

Extensive transcriptomic analyses across 29 Oenothera species have revealed significant evolutionary dynamics in photosystem-related gene families:

  • Heterogeneous gene family evolution: There is wide heterogeneity in gene family evolution across the Oenothera genus, with section Oenothera exhibiting the most pronounced evolutionary changes. This suggests adaptive responses to different ecological niches .

  • Expansion patterns: More significant gene family expansions have occurred than contractions throughout the evolutionary history of Oenothera, suggesting positive selection for functional diversification rather than genomic streamlining .

  • Related metabolic pathway evolution: Phenolic metabolism, which interfaces with photosynthetic processes, has undergone rapid evolution in Oenothera. Specifically:

    • 1,568 phenolic genes arranged into 83 multigene families have been identified

    • 33 gene families show rapid genomic turnover

    • Upstream enzymes like phenylalanine ammonia-lyase (PAL) and 4-coumaroyl:CoA ligase (4CL) account for most significant expansions

    • These gene families have gained approximately 2-fold more genes than they have lost

These evolutionary patterns suggest both adaptive and neutral evolutionary processes have contributed to the diversification of photosynthetic machinery in Oenothera, with implications for understanding photosystem adaptability and functional optimization in different environments.

How do phenolic compounds in Oenothera biennis potentially interact with photosystem proteins?

Oenothera biennis contains a rich profile of phenolic compounds that may interact with photosystem proteins through various mechanisms. These interactions could influence photosynthetic efficiency, photoprotection, and stress responses:

  • Phenolic antioxidant protection: Oenothera contains significant amounts of phenolic acids including:

Phenolic AcidTotal Content (mg/100g)
Protocatechuic63.40 ± 2.56
Gallic14.81 ± 1.78
Caffeic7.51 ± 0.33
2-hydroxy-4-methoxybenzoic7.35 ± 0.41
m-Coumaric5.73 ± 0.50
Ferulic5.02 ± 0.32
p-Hydroxybenzoic4.79 ± 0.26

These compounds can serve as antioxidants that protect photosystem proteins from reactive oxygen species generated during photosynthesis under high light or stress conditions .

  • Flavonoid-protein interactions: Oenothera biennis contains numerous flavonoids including quercetin and kaempferol derivatives that may:

    • Non-covalently bind to photosystem proteins, potentially modulating their structure

    • Influence the lipid environment of thylakoid membranes where photosystems are embedded

    • Alter energy transfer dynamics within the photosynthetic apparatus

  • Ellagitannin interference: Oenothera leaves contain ellagitannins such as oenothein A and oenothein B that may interact with photosystem proteins through:

    • Protein precipitation mechanisms

    • Alteration of membrane fluidity

    • Modulation of proton gradients across thylakoid membranes

Understanding these interactions is crucial for interpreting photosynthetic efficiency measurements and for engineering strategies aimed at optimizing photosynthesis in Oenothera and related species.

What structural features are critical for PsbQ association with PSII, and how do they differ between plants and cyanobacteria?

The association between PsbQ and Photosystem II involves several critical structural features that differ significantly between plants and cyanobacteria:

  • N-terminal differences:

    • In plants: The N-terminus of PsbQ contains several conserved features critical for PSII association

    • In cyanobacteria: Few of these elements are conserved, suggesting different binding mechanisms

    • Cyanobacterial PsbQ possesses hydrophobic properties conferred by a lipid anchor at its N-terminus, which likely mediates membrane association

  • C-terminal positioning:

    • Structural studies indicate that the C-terminus is positioned far from the face of PsbQ predicted to interact with PSII in plants

    • This positioning allows for C-terminal modifications (such as histidine tagging) without disrupting protein function or association with PSII

    • This feature has been leveraged for protein purification strategies while maintaining functional integrity

  • Functional differences in ion requirements:

    • Cyanobacterial ΔpsbQ mutants display photosynthetic defects specifically under calcium or chloride depletion

    • PsbQ-associated PSII complexes maintain normal oxygen evolution rates under calcium-deficient conditions, suggesting a role in stabilizing the oxygen-evolving complex

    • These ionic dependencies may reflect differential evolutionary adaptations to various aquatic environments

These structural and functional differences have significant implications for comparative studies between plant and cyanobacterial photosystems, as well as for the design of recombinant systems for structural biology or protein engineering applications.

What are the key challenges in expressing and purifying functional recombinant Oenothera photosystem proteins?

Expression and purification of functional recombinant Oenothera photosystem proteins present several significant challenges that researchers must address:

  • Membrane protein expression barriers:

    • Photosystem proteins are integral membrane proteins with multiple transmembrane domains

    • Heterologous expression systems (like E. coli) often struggle with correct folding of plant membrane proteins

    • The hydrophobic nature of these proteins can lead to inclusion body formation or toxicity to host cells

  • Co-factor incorporation:

    • Functional photosystem proteins require correct incorporation of multiple cofactors (chlorophylls, carotenoids, metal ions)

    • E. coli lacks the machinery for chlorophyll synthesis, necessitating either:
      a) Co-expression of chlorophyll biosynthesis genes
      b) Reconstitution with purified pigments post-expression
      c) Use of alternative expression systems like cyanobacteria or algae

  • Post-translational modifications:

    • Plant photosystem proteins often undergo specific post-translational modifications

    • Using E. coli as an expression system means these modifications will be absent

    • This may affect protein folding, stability, or interactions with other components

  • Reconstitution challenges:

    • After purification, maintaining protein stability requires carefully optimized buffer conditions

    • Recommended protocols include reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Addition of 5-50% glycerol is advised for long-term storage

    • Avoiding repeated freeze-thaw cycles is critical for maintaining activity

  • Functional verification:

    • Confirming that recombinant proteins retain native function requires specialized assays

    • Oxygen evolution measurements can verify photosynthetic activity

    • Structural integrity should be confirmed through techniques such as circular dichroism or limited proteolysis

Addressing these challenges requires careful optimization of expression conditions, purification protocols, and storage methods specific to each photosystem protein.

How can researchers differentiate between functional and non-functional recombinant photosystem proteins?

Differentiating between functional and non-functional recombinant photosystem proteins requires a multi-faceted approach combining biochemical, biophysical, and functional analyses:

  • Spectroscopic characterization:

    • UV-visible absorption spectroscopy: Functional photosystem proteins display characteristic absorption peaks corresponding to properly bound chlorophyll and carotenoid pigments

    • Circular dichroism (CD): Provides information about secondary structure integrity

    • Fluorescence emission: Can reveal proper energy transfer between pigments in assembled complexes

  • Oxygen evolution assays:

    • Quantitative measurement of oxygen evolution using a Clark-type electrode

    • Comparison with wild-type activity levels

    • Assessment under both standard and stress conditions (e.g., calcium or chloride depletion)

    • Functional PsbQ-associated PSII complexes typically show higher rates of oxygen evolution compared to the average PSII population

  • Biochemical integrity assessment:

    • SDS-PAGE analysis: Confirms protein size and purity

    • Native-PAGE: Reveals proper complex assembly

    • Immunoblotting: Verifies the presence of specific photosystem components

    • Protein:chlorophyll ratios: Functional complexes maintain specific stoichiometries

  • Stability assays:

    • Thermal stability tests

    • Resistance to photoinhibition

    • Long-term activity retention during storage

    • Functional PsbQ-tagged PSII complexes demonstrate enhanced stability compared to other PSII populations

  • Structural verification:

    • Negative-stain electron microscopy

    • Cryo-electron microscopy for higher resolution assessment

    • Mass spectrometry to confirm proper subunit composition and post-translational modifications

By combining these approaches, researchers can confidently distinguish between properly folded, assembled, and functionally active recombinant photosystem proteins versus misfolded or inactive variants.

What are the potential applications of recombinant Oenothera photosystem proteins in studying photosynthetic efficiency?

Recombinant Oenothera photosystem proteins offer several valuable applications for studying photosynthetic efficiency:

  • Structure-function relationship studies:

    • Site-directed mutagenesis can identify critical residues for photosynthetic efficiency

    • Hybrid systems combining components from different species can elucidate evolutionary adaptations

    • C-terminal tagging approaches (like histidine tags) enable isolation of functional subpopulations of photosystem complexes

  • Environmental adaptation research:

    • Comparison of recombinant proteins from different Oenothera species can reveal adaptations to diverse environments

    • Stress response studies under controlled conditions (temperature, light intensity, nutrient availability)

    • Investigation of species-specific differences in photoinhibition resistance

  • Photosynthetic complex assembly studies:

    • Tagged proteins enable tracking of assembly intermediates

    • Pulse-chase experiments with recombinant components can elucidate assembly kinetics

    • Comparison between PsbQ-associated and other PSII populations provides insights into assembly quality control mechanisms

  • Comparative genomics applications:

    • Recombinant proteins from multiple Oenothera species allow functional testing of evolutionary hypotheses

    • Assessment of how gene family expansions and contractions affect photosynthetic performance

    • Correlation between genetic divergence and functional adaptations in photosynthetic machinery

  • Bioengineering platforms:

    • Templates for designing enhanced photosynthetic proteins

    • Development of sensors for environmental monitoring

    • Screening systems for compounds that modulate photosynthetic efficiency

These applications contribute to our fundamental understanding of photosynthesis and provide pathways for potential improvement of photosynthetic efficiency in crop plants.

How can comparative studies of photosystem proteins across Oenothera species inform evolutionary adaptation mechanisms?

Comparative studies of photosystem proteins across Oenothera species provide unique insights into evolutionary adaptation mechanisms:

  • Functional diversity assessment:

    • Recombinant proteins from different species can be compared for functional parameters:

      • Quantum efficiency

      • Temperature stability

      • Light saturation points

      • Recovery from photoinhibition

    • These functional differences reflect adaptive responses to specific ecological niches

  • Molecular evolution patterns:

    • Transcriptomic analyses across 29 Oenothera species reveal:

      • Heterogeneous gene family evolution patterns

      • More expansions than contractions in photosynthesis-related gene families

      • Section Oenothera exhibiting the most pronounced evolutionary changes

    • These patterns suggest dynamic adaptation rather than conservation of photosynthetic machinery

  • Structure-function correlations:

    • Sequence variations in photosystem proteins can be mapped to functional differences

    • Molecular modeling based on crystal structures can predict how specific amino acid substitutions affect protein function

    • Recombinant proteins allow experimental verification of these predictions

  • Integration with metabolic adaptation:

    • Phenolic metabolism shows rapid evolution in Oenothera with:

      • 1,568 phenolic genes in 83 multigene families

      • 33 gene families exhibiting rapid genomic turnover

      • 2-fold more genes gained than lost

    • These metabolic adaptations likely interact with photosystem function and protection

  • Convergent vs. divergent evolution analysis:

    • Comparing molecular changes across independent lineages facing similar environmental pressures

    • Identifying instances where different molecular solutions evolved to address similar functional challenges

    • Distinguishing between adaptive and neutral evolutionary processes

These comparative approaches illuminate both the constraints and flexibility in photosynthetic machinery evolution, providing insights that could inform strategies for engineering enhanced photosynthesis in crop plants.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.