Recombinant Oenothera elata subsp. hookeri Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
34-318
Protein Length
Full Length of Mature Protein
Species
Oenothera elata subsp. hookeri (Hooker's evening primrose) (Oenothera hookeri)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDRQVKQV LANGKKGGLNVGAVLILPEGFELAPPARISPEMKERIGNPSFQSYRPTKKNILVIGPVPG QKYSEITFPILSPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGIVS KIIRKEKGGYEITITDASDGRQVVDIIPSGPELLVSEGESIKLDQPLTSNPNVGGFGQGD AEVVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF
Uniprot No.

Target Background

Function

Recombinant Oenothera elata subsp. hookeri Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex facilitates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f and what is its role in photosynthesis?

Apocytochrome f is the protein precursor to cytochrome f, a critical component of the cytochrome b6f complex in the photosynthetic electron transport chain. In Oenothera elata subsp. hookeri, the mature cytochrome f consists of 285 amino acids, preceded by a 33-residue N-terminal signal sequence that directs its import into the chloroplast . The protein functions as an electron carrier between Photosystem II and Photosystem I, facilitating the transfer of electrons from plastoquinol to plastocyanin. This process is essential for generating the proton gradient that drives ATP synthesis during photosynthesis.

The apocytochrome f differs from the functional cytochrome f in that it lacks the covalently attached heme group necessary for electron transport activity. The conversion from apo- to holoprotein occurs within the chloroplast as part of the protein maturation process.

How is the petA gene organized in the plastid genome of Oenothera elata subsp. hookeri?

The petA gene encoding pre-apocytochrome f in Oenothera elata subsp. hookeri has been mapped to a 2.4 kbp HindIII fragment of the circular plastid chromosome . Notably, the gene is positioned distal to the gene for ATP synthase subunit alpha, at the border of a 45 kbp inversion that distinguishes the plastid chromosomes of Oenothera and spinach . Both genes are transcribed in the same direction, suggesting coordinated expression.

Nucleotide sequence analysis reveals that the petA gene contains a single open reading frame encoding 318 amino acids total, including the 33-residue N-terminal signal sequence and the 285-residue mature protein . This organization is consistent with the general structure of plastid-encoded genes, featuring a continuous coding sequence without introns.

What are the structural characteristics of Apocytochrome f in Oenothera compared to other plant species?

Comparative analysis of apocytochrome f sequences from Oenothera hookeri, spinach, wheat, and pea reveals remarkable conservation, with over 80% sequence identity across these diverse plant species . This high degree of conservation indicates strong evolutionary pressure to maintain the structural and functional integrity of this critical photosynthetic protein.

Notable structural features include:

This conservation pattern suggests that while the protein's fundamental function in electron transport has been strictly maintained throughout evolution, some flexibility exists in the mechanisms of its import and processing within the chloroplast.

What techniques are most effective for expressing recombinant Oenothera elata Apocytochrome f?

Successful expression of recombinant Oenothera elata apocytochrome f requires careful consideration of expression systems and purification strategies. The following methodological approach has proven effective:

Expression System Selection:

  • Bacterial systems (E. coli): Best for high yield but may lack post-translational modifications

  • Plant-based expression systems: Provide more authentic processing but with lower yields

  • Cell-free systems: Useful for avoiding toxicity issues that may arise from membrane protein expression

Optimization Protocol:

  • Clone the petA gene without the N-terminal signal sequence (focus on the 285 amino acid mature protein)

  • Incorporate affinity tags (His6 or GST) for purification

  • Use low-temperature induction (16-18°C) to improve proper folding

  • Include molecular chaperones to enhance solubility

Purification Strategy:

  • Initial capture via affinity chromatography

  • Secondary purification through ion exchange chromatography

  • Final polishing via size exclusion chromatography

The major challenge in this process is obtaining correctly folded protein, as apocytochrome f is normally inserted into membranes. Detergent screening (typically using mild non-ionic detergents like DDM or Triton X-100) is essential for maintaining protein stability during purification.

How can researchers verify the structural integrity of recombinant Apocytochrome f?

Verification of structural integrity for recombinant apocytochrome f requires a multi-technique approach:

Spectroscopic Methods:

  • Circular Dichroism (CD): To assess secondary structure content

  • Fluorescence Spectroscopy: To evaluate tertiary structure through intrinsic tryptophan fluorescence

  • Nuclear Magnetic Resonance (NMR): For detailed structural analysis of smaller domains

Functional Assays:

  • Heme binding capacity: Ability to be converted to holocytochrome f

  • Electron transfer activity: Using artificial electron donors/acceptors

Biophysical Characterization:

  • Thermal shift assays: To assess protein stability

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS): To confirm monomeric state

A properly folded recombinant apocytochrome f should demonstrate specific spectroscopic signatures, appropriate oligomeric state, and the capacity to bind heme and participate in electron transfer reactions when properly reconstituted.

What experimental approaches can elucidate the interaction between Apocytochrome f and other components of the photosynthetic electron transport chain?

Investigating protein-protein interactions within the photosynthetic electron transport chain requires sophisticated methodological approaches:

In Vitro Interaction Studies:

  • Surface Plasmon Resonance (SPR): To determine binding kinetics between purified apocytochrome f and plastocyanin

  • Isothermal Titration Calorimetry (ITC): For thermodynamic characterization of binding

  • Crosslinking Mass Spectrometry: To identify interaction interfaces

Structural Biology Approaches:

  • X-ray Crystallography: Of co-crystallized complexes

  • Cryo-Electron Microscopy: For larger assemblies like the cytochrome b6f complex

  • Hydrogen-Deuterium Exchange Mass Spectrometry: To map interaction surfaces

Computational Methods:

  • Molecular Docking: To predict binding modes

  • Molecular Dynamics Simulations: To study the dynamics of protein-protein interactions

These approaches can reveal critical residues involved in electron transfer and provide insights into the molecular mechanisms underlying the efficiency of photosynthetic electron transport.

How can site-directed mutagenesis be applied to investigate the structure-function relationship of Apocytochrome f?

Site-directed mutagenesis offers powerful insights into structure-function relationships of apocytochrome f. A systematic approach includes:

Target Selection Strategy:

  • Conserved residues identified through sequence alignment of apocytochrome f from Oenothera elata and other species (>80% conservation)

  • Residues predicted to interact with electron transport partners

  • Amino acids involved in heme binding

Mutation Types and Rationale:

Mutation TypeResidue ExamplesFunctional Investigation
ConservativeLys→Arg, Asp→GluImportance of charge maintenance
Non-conservativeLys→Ala, His→AlaCritical functional role assessment
Charge reversalLys→Asp, Asp→LysElectrostatic interaction mapping
Cys replacementCys→Ser/AlaHeme attachment site verification

Functional Assay Battery:

  • Heme incorporation efficiency

  • Electron transfer rates to plastocyanin

  • Protein stability assessments

  • Assembly into the cytochrome b6f complex

This methodical mutation approach, followed by comprehensive characterization, can map functional domains and critical residues within the apocytochrome f structure, revealing mechanistic insights into electron transport processes.

What is the significance of the plastid genome organization around the petA gene in Oenothera elata?

The genomic context of the petA gene in Oenothera elata subsp. hookeri provides fascinating insights into chloroplast genome evolution:

The petA gene is located at a significant position - near the border of a 45 kbp inversion that distinguishes Oenothera and spinach plastid chromosomes . This positioning is noteworthy for several reasons:

  • The gene's location adjacent to the ATP synthase subunit alpha gene, with both transcribed in the same direction , suggests potential co-regulation or co-expression mechanisms.

  • The positioning at an inversion boundary represents a landmark for comparative genomic studies across plant species, allowing researchers to track major reorganization events in plastid genome evolution.

  • Such inversions can affect gene expression through altered promoter contexts or by disrupting operonic structures, making the maintained functionality of petA despite genome reorganization particularly interesting.

This genomic arrangement in Oenothera provides an excellent model system for studying how plastid genomes maintain functional integrity despite structural rearrangements during evolution. It also offers insights into the plasticity of chloroplast genomes and the constraints on their reorganization imposed by the need to maintain essential photosynthetic functions.

How does the N-terminal signal sequence of Oenothera Apocytochrome f compare with other species, and what are the functional implications?

The N-terminal signal sequence of apocytochrome f in Oenothera hookeri exhibits notable differences compared to other plant species:

Comparative Analysis:
The putative pre-sequence in Oenothera is 33 amino acids long, which is 2 residues shorter than those known from spinach, wheat, and pea proteins . This difference, despite the high conservation (>80%) of the mature protein sequence across these species , suggests evolutionary flexibility in the transit peptide while maintaining strict conservation of the functional domains.

Functional Implications:

  • Import Efficiency: Variations in signal sequence length may affect the efficiency of protein import into the chloroplast, potentially reflecting adaptations to different cellular environments or plastid import machinery.

  • Processing Mechanisms: Different signal sequences might engage with distinct proteolytic processing enzymes or recognition factors during import.

  • Evolutionary Adaptation: The higher variability in signal sequences compared to mature protein regions suggests relaxed selective pressure on the transit peptide, allowing for species-specific optimization.

  • Experimental Considerations: When designing expression systems for recombinant production, researchers must consider these species-specific differences in signal sequences to optimize proper targeting and processing.

This variation in signal sequence length provides a natural experiment for understanding the flexibility and constraints in chloroplast protein import mechanisms across plant species.

What bioinformatic tools are most effective for analyzing the conservation and evolution of Apocytochrome f across plant species?

Effective bioinformatic analysis of apocytochrome f requires a strategic combination of tools:

Sequence Analysis Pipeline:

  • Primary Sequence Analysis:

    • BLAST/PSI-BLAST: Identification of homologs across plant species

    • Clustal Omega/MUSCLE: Multiple sequence alignment

    • JalView: Visualization of conservation patterns

  • Evolutionary Analysis:

    • MEGA/PhyML: Phylogenetic tree construction

    • PAML: Detection of selection signatures

    • ConSurf: Mapping conservation onto protein structures

  • Structural Bioinformatics:

    • I-TASSER/AlphaFold2: Protein structure prediction

    • PyMOL/Chimera: Visualization of structural conservation

    • FoldX: Stability prediction of mutations

Analytical Outcomes:
This pipeline can reveal patterns of conservation that correspond to functional domains. For instance, the high conservation (>80%) observed between Oenothera, spinach, wheat, and pea cytochromes f likely reflects strict functional constraints on the protein's role in electron transport.

By mapping sequence conservation onto structural models, researchers can identify critical functional regions including:

  • Heme-binding domains

  • Protein-protein interaction interfaces

  • Membrane-association regions

This integrated bioinformatic approach provides a foundation for targeted experimental design, prioritizing regions and residues for functional characterization.

How can researchers integrate omics data to understand the role of Apocytochrome f in broader photosynthetic processes?

Multi-omics integration provides comprehensive insights into apocytochrome f's role in photosynthesis:

Data Integration Framework:

Omics LayerTechniqueInsight Provided
GenomicsWhole genome sequencingpetA gene context and regulatory elements
TranscriptomicsRNA-SeqExpression patterns under different conditions
ProteomicsLC-MS/MSPost-translational modifications, protein abundance
MetabolomicsGC-MS/LC-MSMetabolic impacts of cytochrome f alterations
PhenomicsChlorophyll fluorescenceFunctional impact on photosynthetic efficiency

Integration Methodology:

  • Data Normalization: Account for differences in scale and distribution across omics platforms

  • Correlation Networks: Identify genes, proteins, and metabolites that co-vary with petA expression

  • Pathway Enrichment: Map integrated data to photosynthetic and related metabolic pathways

  • Machine Learning Approaches: Use supervised learning to identify features predictive of photosynthetic efficiency

Application Example:
By correlating apocytochrome f expression and modification states with metabolite profiles and photosynthetic parameters, researchers can identify previously unrecognized regulatory mechanisms and metabolic consequences of alterations in electron transport chain components.

This integrated approach is particularly valuable for understanding how environmental stresses impact photosynthetic efficiency through effects on the cytochrome b6f complex, offering potential avenues for improving crop productivity under changing climate conditions.

What are the unresolved questions regarding the assembly and regulation of Apocytochrome f in plastid bioenesis?

Despite extensive research, several critical questions about apocytochrome f remain unanswered:

  • Assembly Chaperones: The identity and mechanism of action of specific chaperones that assist in the proper folding and membrane insertion of apocytochrome f remain poorly characterized.

  • Coordinated Assembly: How the assembly of apocytochrome f is coordinated with other components of the cytochrome b6f complex to ensure stoichiometric incorporation remains unclear.

  • Regulatory Mechanisms: The transcriptional and post-transcriptional regulatory mechanisms that control petA gene expression in response to developmental and environmental cues require further investigation.

  • Degradation Pathways: The pathways responsible for the turnover and degradation of damaged or excess apocytochrome f are not fully understood.

  • Heme Attachment: The precise mechanism and regulation of covalent heme attachment during the conversion from apo- to holocytochrome f warrants deeper exploration.

These knowledge gaps provide fertile ground for future research, potentially revealing new insights into chloroplast biogenesis and the maintenance of photosynthetic efficiency under varying conditions.

How might advanced structural biology techniques enhance our understanding of Oenothera elata Apocytochrome f function?

Recent advances in structural biology offer unprecedented opportunities for detailed functional characterization:

Emerging Methodological Approaches:

  • Cryo-Electron Microscopy (Cryo-EM): Recent advances in detector technology and image processing algorithms now allow near-atomic resolution of membrane protein complexes. This technique could reveal the precise arrangement of apocytochrome f within the native cytochrome b6f complex.

  • Integrative Structural Biology: Combining X-ray crystallography, NMR, Cryo-EM, and computational modeling can provide complementary insights into different aspects of protein structure and dynamics.

  • Time-Resolved Structural Methods: Techniques like time-resolved X-ray crystallography and time-resolved Cryo-EM can capture structural changes during electron transport, providing dynamic models of function.

  • Single-Molecule Approaches: Methods like single-molecule FRET can track conformational changes in individual apocytochrome f molecules during electron transfer events.

Anticipated Research Impacts:

These advanced structural approaches could resolve longstanding questions about:

  • The precise electron transfer pathway through the protein

  • Conformational changes associated with redox state alterations

  • The detailed mechanism of interaction with plastocyanin

  • The structural basis for the high efficiency of photosynthetic electron transfer

Such insights would not only advance fundamental understanding of photosynthesis but could also inform biotechnological approaches to enhancing photosynthetic efficiency in crop plants.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.