Recombinant Oenothera elata subsp. hookeri ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Important: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Oenothera elata subsp. hookeri (Hooker's evening primrose) (Oenothera hookeri)
Target Names
atpI
Target Protein Sequence
MDVLSCSNNTLKGLYDISGVEVGQHFYWQIGGFQVHGQVLITSWVVIAILLGSASIAVRN PQTIPNDSQNFFEYILEFIRDVSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKLV ELPHGELAAPTNDINTTVALALLTSVAYFYAGLSKKGLGYFSKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function
This protein serves as a key component of the proton channel, playing a direct role in the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is ATP synthase subunit a in Oenothera elata and what is its significance?

ATP synthase subunit a (atpI) in Oenothera elata subsp. hookeri (Hooker's evening primrose) is a chloroplastic protein that forms part of the membrane-embedded F₀ sector of ATP synthase. This protein is critical for the functionality of the ATP synthase complex, which catalyzes ATP synthesis during photophosphorylation in chloroplasts . The significance of studying this protein lies in understanding the fundamental mechanisms of bioenergetics, particularly how proton translocation across membranes is coupled to ATP synthesis. Research on atpI contributes to our understanding of energy conservation in photosynthetic organisms and may provide insights into the evolution of energy transduction mechanisms across different species .

ATP synthase complexes are ubiquitous enzymes responsible for the bulk of ATP production during oxidative or photophosphorylation in aerobic organisms. These highly asymmetric enzymes utilize the energy inherent in proton gradients across energy-coupling membranes to form high-energy anhydride bonds during ATP synthesis . In chloroplasts, this process is fundamental to capturing the energy harvested from light during photosynthesis.

How should recombinant atpI protein be stored and reconstituted for optimal research use?

Proper storage and reconstitution of recombinant atpI are crucial for maintaining protein integrity and experimental reproducibility. According to manufacturer recommendations, the shelf life of recombinant atpI is dependent on several factors including storage state, buffer ingredients, storage temperature, and the inherent stability of the protein itself .

For liquid formulations, the recommended storage period is 6 months at -20°C/-80°C, while lyophilized forms can be stored for up to 12 months at -20°C/-80°C . Researchers should avoid repeated freezing and thawing cycles as these can compromise protein structure and activity. Working aliquots can be stored at 4°C for up to one week .

For reconstitution, the following protocol is recommended:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation)

  • Aliquot for long-term storage at -20°C/-80°C

This methodology helps ensure protein stability and activity for downstream experimental applications.

What are the structural characteristics of ATP synthase subunit a and its role in the ATP synthase complex?

ATP synthase subunit a (atpI) is a membrane-embedded component of the F₀ sector of ATP synthase. In the chloroplast ATP synthase complex, it functions as part of the proton channel, working in concert with other subunits to facilitate proton translocation across the thylakoid membrane .

The structure of subunit a is characterized by multiple transmembrane helices that form part of the stator assembly, which remains stationary during the rotational catalysis performed by the enzyme. Specifically, subunit a works in conjunction with the c-ring to catalyze proton translocation, which drives the rotary motion essential for ATP synthesis .

The ATP synthase complex consists of two major sectors:

  • F₁ sector: Contains subunits α, β, γ, δ, and ε in a 3:3:1:1:1 stoichiometry

  • F₀ sector: Membrane-embedded, includes subunit a among others

The F₀ sector in bacterial systems consists of three types of subunits (a, b, and c) with a stoichiometry of ab₂c₁₀₋₁₅ . While there are variations across species, the fundamental architecture and functional mechanisms are conserved. The concerted action of subunits a and c drives the rotary motion of the c-ring, which is transmitted to the internal stalk (subunits γ and ε), ultimately resulting in conformational changes at the catalytic sites that enable ATP synthesis .

What techniques are most effective for studying the function and interactions of recombinant atpI?

Several complementary techniques have proven effective for investigating atpI function and interactions:

Proteomics and Mass Spectrometry:
Mass spectrometry has been successfully employed to identify and quantify ATP synthase subunits, including atpI, and to assess their interactions. This technique is particularly valuable for determining the composition and stoichiometry of ATP synthase complexes and subcomplexes .

Sequence-Based Structure Prediction:
Computational approaches using sequence-based structure prediction can identify important structural features of atpI. For instance, analysis of b-subunits (which interact with subunit a) from bacterial, cyanobacterial, and plant sources revealed heptad repeats suggesting coiled-coil structures despite limited sequence similarity .

Molecular Modeling:
Molecular modeling techniques can provide insights into the three-dimensional structure and packing of atpI and its interactions with other subunits. This approach has been used to model the E. coli b-subunit homodimer, providing insights that might be applicable to understanding atpI interactions .

Electron Spin Resonance (ESR) Spectroscopy with Site-Directed Spin Labeling:
This technique has been effectively used to study the structure and interfacial packing of ATP synthase subunits. It provides valuable information about the dynamics and relative positioning of specific residues within the protein complex .

Genetic Approaches:
Mutational analysis, including the use of CRISPR-Cas9 gene editing to create knockout mutants, has been instrumental in understanding ATP synthase biogenesis and function. Such studies have demonstrated that peripheral stalk subunits are essential for ATP synthase assembly and function .

Reconstitution Experiments:
In vitro reconstitution of ATP synthase complexes using recombinant subunits allows for the assessment of functional interactions and assembly requirements. This approach can be particularly useful for determining the specific contribution of atpI to complex formation and enzymatic activity.

How can researchers assess the purity and functional integrity of recombinant atpI preparations?

Ensuring the purity and functional integrity of recombinant atpI is crucial for reliable experimental outcomes. The following methodologies are recommended:

SDS-PAGE Analysis:
Sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) is the standard method for assessing protein purity. Commercial recombinant atpI preparations typically have a purity of >85% as determined by SDS-PAGE . Researchers should verify this specification upon receipt and before experimental use.

Western Blotting:
Immunoblotting using antibodies specific to atpI or to tags incorporated during recombinant expression can confirm the identity of the protein and detect potential degradation products.

Mass Spectrometry:
For a more detailed assessment of protein integrity, mass spectrometry can identify post-translational modifications, truncations, or other alterations that might affect protein function.

Functional Assays:
While direct functional assays for isolated atpI may be challenging due to its role as part of a larger complex, reconstitution into liposomes or nanodiscs followed by proton translocation assays can provide information about functional integrity.

Circular Dichroism (CD) Spectroscopy:
CD spectroscopy can assess the secondary structure content of the protein, providing information about proper folding and structural integrity.

Thermal Shift Assays:
These assays measure protein stability and can be useful for comparing different batches or storage conditions of recombinant atpI.

For tagged recombinant proteins, it's important to note that "tag type will be determined during the manufacturing process" , which may influence the choice of detection and purification methods.

How does ATP synthase assembly and stoichiometry regulation occur in chloroplasts?

The assembly of ATP synthase in chloroplasts involves a complex interplay between nuclear-encoded and chloroplast-encoded subunits, with intricate regulatory mechanisms ensuring proper stoichiometry .

Recent research has uncovered a translational feedback loop operating in two steps along the assembly pathway of CF₁ (the chloroplast F₁ sector):

  • Production of the nucleus-encoded subunit γ is required for sustained translation of the chloroplast-encoded subunit β

  • Subunit β, in turn, stimulates the expression of the chloroplast-encoded subunit α

This mechanism ensures the unique 3:3:1:1:1 stoichiometry (α:β:γ:δ:ε) required for the functional assembly of the chloroplast enzyme .

The translational downregulation of subunits β or α, when not assembled, is mediated by the 5′UTRs of their own mRNAs, indicating a regulation at the level of translation initiation. Specifically, subunit γ, by assembling with α₃β₃ hexamers, releases a negative feedback exerted by α/β assembly intermediates on translation of subunit β. Moreover, translation of subunit α is transactivated by subunit β .

Additionally, peripheral stalk subunits play crucial roles in ATP synthase biogenesis. Studies in Chlamydomonas reinhardtii have shown that mutants affecting the two peripheral stalk subunits b and b′, encoded respectively by the atpF and ATPG genes, have impaired ATP synthase assembly. While a knock-down ATPG mutant showed small accumulation of functional ATP synthase, knock-out ATPG mutants completely prevented ATP synthase function and accumulation, as also observed in an atpF frame-shift mutant .

This intricate regulatory network highlights the evolutionary adaptation ensuring coordinated production of ATP synthase components from two genetic compartments (nucleus and chloroplast).

What are the structural and functional differences between atpI in Oenothera elata and homologous proteins in other species?

ATP synthase subunit a shows varying degrees of conservation across species, with important implications for structure and function.

Sequence Comparisons:
Comparisons of bacterial, cyanobacterial, and plant b-subunits (which interact with subunit a) demonstrated little sequence similarity, suggesting potential structural differences in the ATP synthase complexes across these organisms . This variation likely extends to subunit a as well.

Functional Implications:
The evolutionary divergence in ATP synthase subunits reflects adaptation to different energy needs and environmental conditions. For instance, the plant-specific features of chloroplast ATP synthase, including its atpI component, are likely adaptations to the unique requirements of photosynthetic energy transduction.

Studies involving chimeric constructs have shown that parts of the tether domain of bacterial b-subunits could be exchanged for sequences from cyanobacterial ATP synthase bb′-subunits, suggesting "limited, but required specificity in protein-protein interaction" . This observation may be relevant to understanding the functional constraints on atpI evolution.

The recent finding that chloroplast ATP synthase biogenesis requires specific interactions between peripheral stalk subunits further highlights the importance of species-specific adaptations in ATP synthase assembly and function.

What role does the atpI gene play in the context of chloroplast genome evolution?

The atpI gene, encoding ATP synthase subunit a, provides important insights into chloroplast genome evolution and nuclear-chloroplast coevolution.

Endosymbiotic Gene Transfer and Retention:
In the context of endosymbiotic theory, the retention of atpI in the chloroplast genome rather than transfer to the nuclear genome reflects the ongoing evolutionary process of organellar genome reduction and reorganization. The retention of certain genes in organellar genomes may be related to their hydrophobicity (making nuclear-encoded versions difficult to import) or regulatory requirements .

Nuclear-Chloroplast Coordination:
The coordinated production of ATP synthase subunits from both nuclear and chloroplast genomes necessitates sophisticated regulatory mechanisms. Research in Chlamydomonas reinhardtii has identified a novel octotricopeptide repeat (OPR) protein, MDE1, that is required to stabilize the chloroplast-encoded atpE mRNA . This illustrates the evolution of nuclear factors that regulate chloroplast gene expression.

In the perspective of primary endosymbiosis (~1.5 billion years ago), the recruitment of nuclear factors like MDE1 to chloroplast gene targets exemplifies nucleus/chloroplast interplay that evolved relatively recently, in the ancestor of the CS clade of Chlorophyceae, approximately 300 million years ago . While this specific example pertains to atpE rather than atpI, it illustrates the evolutionary dynamics that likely apply to atpI as well.

Conservation Patterns:
The patterns of conservation and divergence in atpI sequences across species can provide insights into the functional constraints and adaptive evolution of ATP synthase. Comparative genomic analyses of atpI from diverse photosynthetic organisms could reveal signatures of selection related to specific environmental adaptations or metabolic requirements.

What are the optimal conditions for expressing and purifying recombinant atpI for structural studies?

Expressing and purifying membrane proteins like atpI presents specific challenges that require careful optimization. Based on current best practices and the information provided about commercial recombinant atpI , the following approaches are recommended:

Expression Systems:
Baculovirus expression systems have proven effective for producing recombinant atpI . This system is particularly suitable for membrane proteins as it provides a eukaryotic environment with appropriate post-translational modifications and membrane insertion machinery.

Alternative expression systems to consider include:

  • Bacterial systems (E. coli) with specialized strains designed for membrane protein expression

  • Yeast expression systems (Pichia pastoris or Saccharomyces cerevisiae)

  • Cell-free expression systems, which can be advantageous for toxic membrane proteins

Purification Strategy:
For structural studies, high purity (>95%) is typically required, which may necessitate multiple purification steps:

  • Initial extraction using detergents appropriate for membrane proteins (e.g., DDM, LMNG, or OG)

  • Affinity chromatography utilizing tags incorporated during recombinant expression

  • Size exclusion chromatography to remove aggregates and ensure homogeneity

  • Ion exchange chromatography for final polishing if needed

Protein Stabilization:
To maintain structural integrity during purification and subsequent analyses:

  • Include appropriate detergents above their critical micelle concentration throughout purification

  • Consider the addition of lipids or use of nanodiscs/lipid nanodiscs for stabilization

  • Optimize buffer conditions (pH, salt concentration, presence of glycerol)

  • Maintain cold temperatures throughout the process to minimize degradation

Quality Control:
Regular assessment of protein quality is essential:

  • SDS-PAGE and Western blotting to monitor purity and degradation

  • Size exclusion chromatography to assess homogeneity and aggregation state

  • Mass spectrometry to confirm protein identity and integrity

  • Functional assays where possible to verify biological activity

For reconstitution after purification, following the manufacturer's recommendations for recombinant atpI can serve as a starting point , with modifications as needed based on the specific requirements of structural studies.

How can researchers address challenges in studying atpI interactions with other ATP synthase subunits?

Investigating interactions between atpI and other ATP synthase subunits presents several challenges due to the membrane-embedded nature of these interactions and the complexity of the ATP synthase complex. The following methodological approaches can help overcome these challenges:

Co-immunoprecipitation with Crosslinking:
Chemical crosslinking prior to extraction can capture transient or detergent-sensitive interactions. This approach has been used successfully to study interactions between ATP synthase subunits .

Blue Native PAGE:
This technique preserves protein-protein interactions and can resolve intact ATP synthase complexes and subcomplexes, allowing for the identification of assembly intermediates or altered complexes in mutant strains .

Cryo-electron Microscopy:
Recent advances in cryo-EM have revolutionized structural studies of membrane protein complexes. This technique can provide high-resolution structural information about ATP synthase, including the position and interactions of atpI .

Genetic Approaches:

  • Suppressor Mutation Analysis: Identifying mutations that suppress the phenotype of atpI mutations can reveal functional interactions

  • Site-Directed Mutagenesis: Systematic mutation of residues in atpI can identify those critical for interactions with other subunits

  • Chimeric Constructs: Creating chimeric proteins combining regions from different species can identify interaction-specific domains

Reconstitution Experiments:
In vitro reconstitution of ATP synthase from purified components can allow for the systematic investigation of subunit requirements and interactions. This approach has been applied successfully to study bacterial ATP synthases .

Computational Approaches:
Molecular dynamics simulations and protein-protein docking can provide insights into potential interaction surfaces and the dynamics of subunit associations. These computational predictions can guide experimental design .

Proteomics with Quantitative Mass Spectrometry:
Advanced proteomics approaches, such as SILAC (Stable Isotope Labeling with Amino acids in Cell culture) or TMT (Tandem Mass Tags), can quantitatively assess changes in protein-protein interactions under different conditions or in different mutant backgrounds .

What methodologies can be used to investigate the role of atpI in proton translocation and ATP synthesis?

Understanding the specific contribution of atpI to proton translocation and ATP synthesis requires specialized techniques that can probe both structure and function. The following methodologies are particularly relevant:

Site-Directed Mutagenesis and Functional Assays:
Systematic mutation of conserved residues in atpI can identify those critical for proton translocation. Subsequent functional assays can measure:

  • ATP synthesis rates in reconstituted systems

  • Proton translocation using pH-sensitive fluorescent dyes

  • Membrane potential generation using potential-sensitive probes

Biophysical Approaches:

  • Solid-State NMR: Can provide atomic-level insights into the structure and dynamics of membrane-embedded atpI

  • Electron Paramagnetic Resonance (EPR) Spectroscopy: Using site-directed spin labeling, can measure distances between specific residues and monitor conformational changes during catalysis

  • Fluorescence Resonance Energy Transfer (FRET): Can monitor dynamic interactions and conformational changes during the catalytic cycle

Reconstitution into Nanodiscs or Liposomes:
Reconstituting purified atpI (alone or with other subunits) into membrane mimetics allows for controlled studies of its function:

  • Measurement of proton pumping activity using pH indicators

  • Assessment of the impact of lipid composition on activity

  • Determination of the minimal subunit requirements for proton translocation

Genetic Approaches in Model Organisms:

  • Creation of point mutations in conserved residues of atpI

  • Analysis of suppressors that restore function in atpI mutants

  • Construction of chimeric atpI proteins to identify functional domains

Structural Analysis:

  • Cryo-electron microscopy of ATP synthase complexes can reveal the structural basis of atpI's role in proton translocation

  • X-ray crystallography of ATP synthase subcomplexes or fragments can provide high-resolution structural details

  • Hydrogen/deuterium exchange mass spectrometry can identify regions involved in dynamic processes

Computational Simulations:
Molecular dynamics simulations can model proton movement through the a/c subunit interface and predict the effects of mutations, providing testable hypotheses about the mechanism of proton translocation.

How might research on atpI contribute to our understanding of bioenergetic diseases and disorders?

Research on ATP synthase subunit a (atpI) has significant implications for understanding bioenergetic diseases and disorders, particularly those involving energy metabolism and mitochondrial function:

Mechanistic Insights into Mitochondrial Disorders:
While atpI in Oenothera elata is chloroplastic, the fundamental mechanisms of ATP synthase function are conserved between chloroplasts and mitochondria. Insights gained from studying the chloroplast enzyme can inform our understanding of mitochondrial ATP synthase, mutations in which are associated with numerous disorders including neuropathy, ataxia, retinitis pigmentosa (NARP), and maternally inherited Leigh syndrome (MILS) .

Structural Basis for Pathogenic Mutations:
Detailed structural and functional studies of atpI can provide a framework for interpreting the effects of pathogenic mutations in the mitochondrial ATP6 gene (the mitochondrial homolog of chloroplast atpI). Understanding how specific residues contribute to proton translocation and subunit interactions can help explain how mutations disrupt these functions in disease states.

Therapeutic Development:
Mechanistic insights derived from atpI research could guide the development of therapeutic approaches:

  • Design of small molecules that could modulate ATP synthase function

  • Development of gene therapy strategies for mitochondrial disorders

  • Identification of potential bypass mechanisms that could compensate for ATP synthase defects

Biomarker Discovery:
Understanding the normal assembly and regulation of ATP synthase can help identify potential biomarkers for early detection of bioenergetic disorders, potentially including altered levels of ATP synthase subunits or assembly intermediates in accessible tissues or body fluids.

Agricultural and Biotechnological Applications:
Insights from atpI research may also have applications in addressing plant energy metabolism disorders, potentially leading to improved crop yields or stress resistance. Additionally, engineered ATP synthases could have biotechnological applications in artificial photosynthesis or biofuel production .

What potential exists for developing recombinant atpI variants with enhanced properties for biotechnological applications?

The engineering of recombinant atpI variants offers exciting possibilities for various biotechnological applications, leveraging our understanding of ATP synthase structure and function:

Enhanced Energy Conversion Efficiency:
Engineered atpI variants could potentially improve the efficiency of ATP synthesis in biotechnological applications:

  • Modified proton channels with altered conductance properties

  • Variants with optimized interactions with other subunits to enhance coupling efficiency

  • Thermostable variants for applications requiring operation at elevated temperatures

Biosensors and Diagnostic Tools:
Modified atpI proteins could serve as components of biosensors:

  • pH-responsive elements in biosensing applications

  • Probes for membrane potential in cellular systems

  • Components of ATP-dependent reporter systems

Biofuel Production:
Engineered ATP synthases incorporating modified atpI could be employed in bioenergy applications:

  • Components of artificial photosynthetic systems for solar energy conversion

  • Elements in bioreactors for ATP-dependent biosynthetic processes

  • Energy-harvesting components in microbial fuel cells

Pharmaceutical Applications:
Recombinant atpI could be developed for therapeutic purposes:

  • As a target for drug discovery screens

  • As a component of drug delivery systems powered by proton gradients

  • As a model system for studying inhibitors of ATP synthesis with potential antimicrobial applications

Approaches to Engineering atpI:
Several strategies could be employed to develop enhanced atpI variants:

  • Directed Evolution: High-throughput screening of randomly generated variants for desired properties

  • Rational Design: Structure-guided modification of specific residues based on mechanistic understanding

  • Domain Swapping: Creating chimeric proteins incorporating functional elements from different species

  • Computational Design: Using in silico approaches to predict modifications that might confer desired properties

The development of recombinant atpI variants with enhanced properties would benefit from the molecular methodologies described earlier, including site-directed mutagenesis, heterologous expression systems, and functional reconstitution approaches.

How do environmental factors affect the expression and function of atpI in Oenothera elata?

Understanding the influence of environmental factors on atpI expression and function is crucial for both basic research and potential biotechnological applications:

Light Intensity and Quality:
As a component of the photosynthetic apparatus, ATP synthase function is inherently linked to light conditions. Studies in Chlamydomonas reinhardtii have shown that high light sensitivity can be a phenotype of ATP synthase mutations , suggesting that light intensity modulates the expression or function of ATP synthase components, potentially including atpI.

Research approaches to investigate this relationship could include:

  • Transcriptomic and proteomic analyses under varying light conditions

  • Measurement of ATP synthase activity and assembly in plants grown under different light regimes

  • Investigation of post-translational modifications of atpI in response to light stress

Temperature Effects:
Temperature influences membrane fluidity and protein dynamics, potentially affecting atpI function:

  • Studies of ATP synthase activity across temperature gradients

  • Analysis of atpI expression and ATP synthase assembly at different growth temperatures

  • Investigation of potential temperature-dependent post-translational modifications

Nutrient Availability:
Research on Oenothera elata has demonstrated that fertility requirements affect plant growth and development , which may indirectly influence ATP synthase expression and function:

  • Analysis of atpI expression under varying nutrient conditions, particularly nitrogen levels

  • Investigation of potential regulatory mechanisms linking nutrient sensing to ATP synthase biogenesis

  • Study of ATP synthase activity and efficiency under nutrient limitation

Water Availability:
As Oenothera elata is found in habitats ranging from xeric to mesic , water availability likely influences its physiology, including energy metabolism:

  • Comparative analysis of atpI expression and ATP synthase assembly under different irrigation regimes

  • Investigation of drought-responsive regulatory elements in atpI or genes encoding interacting proteins

  • Assessment of ATP synthase function and efficiency under water-limited conditions

Methodological Approaches:
To study these environmental effects, researchers could employ:

  • Field Studies: Comparing natural populations of Oenothera elata growing in different environments

  • Controlled Growth Experiments: Manipulating specific environmental variables while controlling others

  • Molecular Analyses: Employing transcriptomics, proteomics, and functional assays to assess atpI expression and function

  • Imaging Techniques: Using fluorescence imaging to monitor ATP synthase assembly and localization under different conditions

Understanding these environmental influences not only contributes to basic knowledge of ATP synthase regulation but could also inform agricultural practices for Oenothera cultivation, particularly if it continues to develop as a potential nutraceutical crop .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.