The recombinant Oenothera elata subsp. hookeri ATP synthase subunit b, chloroplastic (atpF) is a genetically engineered protein derived from the Fo sector of the ATP synthase complex in the chloroplasts of this plant species. ATP synthase is critical for ATP production during photosynthesis, utilizing proton gradients to drive ATP synthesis. This recombinant protein is expressed in E. coli with an N-terminal His-tag for purification and structural studies .
The protein sequence of atpF includes motifs critical for proton translocation and subunit interactions:
MKNVTDSFVSLVHWPSAGSFGFNTDILATNPINLSVVLGVLIFFGKGVLSDLLDNRKQRI LNTIRNSEELREGAIEQLEKARARLQDVQIEAEGYRAYGYFGIDEQRHESINSTYKTLEQ LENNKNESIHFEQQRAINQVRQQIFQQALQGALGTLNSCLNNELHLRTISANIGLFGSMK ELTD .
ATP synthase in chloroplasts consists of two sectors:
Fo (Membrane Sector): Contains subunits a, b, c, and d, forming a proton channel.
F1 (Catalytic Sector): Houses subunits α, β, γ, δ, ε, and ζ, responsible for ATP synthesis .
Subunit b (atpF) is part of the Fo sector, contributing to proton translocation and structural stability. In plants, the Fo sector is distinct from bacterial homologs, with variations in heptad repeat structures and coiled-coil domains .
Proton-Driven ATP Synthesis: The subunit facilitates proton movement across the thylakoid membrane, generating energy for ATP production .
Plastome Evolution: Studies on Oenothera plastomes highlight conserved genes like ycf1 and ycf2, which may interact with ATP synthase subunits in lipid metabolism and plastid inheritance .
The recombinant protein is produced in E. coli using standard protocols, with His-tag affinity chromatography enabling high-purity isolation . This system bypasses challenges in isolating native chloroplast proteins.
Plastome Diversity: Complete sequencing of Oenothera plastomes revealed conserved ATP synthase subunit genes, including atpF, despite large inversions in the large single-copy (LSC) region .
Lipid Metabolism Link: Mutations in accD (fatty acid biosynthesis) correlate with chloroplast inheritance strength, suggesting indirect interactions with ATP synthase function .
Structural Flexibility: Bacterial subunit b dimers exhibit flexibility, whereas plant subunits may form rigid stalks, influencing energy transmission to F1 .
ATP synthase subunit b, encoded by the atpF gene, is a critical component of the peripheral stalk of chloroplast ATP synthase. According to studies on Chlamydomonas reinhardtii, this subunit works in conjunction with subunit b' (encoded by the nuclear ATPG gene) to form the peripheral stalk structure that is essential for ATP synthase assembly and stability .
The peripheral stalk serves multiple functions:
Connects the F₁ catalytic sector to the membrane-embedded F₀ sector
Provides structural stability to the entire ATP synthase complex
Acts as a stator to prevent rotation of the α₃β₃ catalytic center during ATP synthesis
Research has demonstrated that knockout mutations in either atpF or ATPG completely prevent ATP synthase accumulation and function, while knockdown mutations (such as those affecting the 3'UTR of ATPG) allow minimal accumulation of functional ATP synthase . This indicates that both peripheral stalk subunits are absolutely required for proper biogenesis of the chloroplast ATP synthase complex.
The atpF gene contains an intron that must be spliced for proper gene expression. Researchers have developed in vitro splicing systems to study this process, particularly using tobacco chloroplast extracts. The methodology involves:
Preparation of pre-mRNA substrate:
Amplify the atpF gene fragment using two successive PCR reactions:
First PCR: Use atpF 5' primer (containing T7 promoter and part of 5' exon) and atpF 3' primer (with part of 3' exon and SacII site)
Second PCR: Use ApaI/T7 primer and the pre-existing 3' primer
Digest the PCR product with ApaI and SacII
Insert into the pIVS vector digested with the same enzymes
Linearize the circular plasmid DNA (atpF.pIVS) using NotI
In vitro splicing reaction:
Prepare a reaction mixture containing:
10 fmol atpF pre-mRNA
4 μl chloroplast extract (5-15 μg protein)
Dithiothreitol, polyethylene glycol, glycerol, RNase inhibitor
30 mM HEPES-KOH (pH 7.7)
Incubate for 2 hours at 28°C
Analyze by gel electrophoresis (spliced mRNA appears at ~340 nt, while pre-mRNA at ~1,040 nt)
This system has been optimized for studying atpF intron splicing and can be adapted for investigating factors affecting splicing efficiency.
For expression and purification of recombinant ATP synthase subunits like atpF, researchers can follow this methodological workflow:
Expression system preparation:
Clone the atpF gene into an expression vector with appropriate tags (6×His, EGFP/mCherry, etc.)
Transform into E. coli BL21(DE3) cells for protein production
Protein expression protocol:
Grow transformed E. coli to mid-log phase (OD₆₀₀ = 0.5-0.7)
Induce protein expression with IPTG
Continue growth at appropriate temperature (typically 16-30°C) for 3-18 hours
Harvest cells by centrifugation
Purification procedure:
Lyse cells using appropriate buffer containing protease inhibitors
Clarify lysate by centrifugation
Perform immobilized metal affinity chromatography (IMAC) using Ni-NTA columns:
Quality control:
Analyze purified protein by SDS-PAGE
Verify identity by Western blotting or mass spectrometry
Assess functionality through appropriate enzymatic or binding assays
These methods can be adapted specifically for atpF from Oenothera elata by optimizing conditions based on the protein's properties and designing appropriate expression constructs.
Frameshift mutations in chloroplast genes can have profound effects on gene expression, but fascinating recoding mechanisms exist to partially correct these mutations. Studies on atpB in Oenothera provide valuable insights:
Effects of frameshift mutations:
Insertion or deletion mutations shift the reading frame, typically resulting in premature termination codons
These mutations generally lead to truncated, non-functional proteins
In Oenothera I-iota mutant, a single adenine insertion (+1A) in an oligoA stretch of atpB was expected to produce a truncated protein
Translational recoding mechanisms:
Ribosomal frameshifting can occur at specific "slippery" sequences
In Oenothera I-iota, full-length AtpB protein was detected despite the frameshift mutation
The efficiency of this recoding depends on:
Experimental approach to study recoding:
Generate transplastomic lines with various frameshift mutations
Compare plants with intact vs. disrupted oligoA stretches
Assess recoding efficiency through:
This knowledge could be applied to study potential frameshift mutations and recoding mechanisms in atpF or other chloroplast genes.
Several molecular marker systems have been developed specifically for Oenothera genetics, enabling researchers to distinguish individual chromosomes, entire haploid genomes (Renner complexes), plastomes, and subplastomes:
PCR-based marker systems:
AFLP (Amplified Fragment Length Polymorphisms):
Useful for distinguishing entire Renner complexes
Can detect polymorphisms without prior sequence knowledge
SSLP (Simple Sequence Length Polymorphisms):
Targets microsatellite regions
Highly polymorphic and can distinguish between closely related strains
CAPS (Cleaved Amplified Polymorphic Sequences):
Application example:
Researchers can monitor interspecific exchanges of genomes, chromosome pairs, and/or plastids during crossing programs by using these marker systems. This is particularly valuable when producing plastome-genome incompatible hybrids or assigning linkage groups to specific chromosomes .
For studying atpF specifically, researchers could design CAPS or SSLP markers targeting this gene region to track its inheritance or detect mutations across different Oenothera strains.
Mutations in ATP synthase components like atpF can significantly impact photosynthetic performance. Based on studies of atpB mutations in Oenothera and tobacco, researchers can employ the following methodological approaches:
Physiological parameters to measure:
Chlorophyll fluorescence parameters:
FV/FM (maximum quantum yield of PSII)
qL (fraction of open PSII centers)
Linear electron flux measurements
Redox state of the PSII acceptor side
Spectroscopic measurements:
Electrochromic shift signal to assess proton conductivity (gH+)
P700 oxidation kinetics to evaluate PSI function
Biochemical analyses:
Experimental approach:
Generate plants with mutations in the gene of interest (e.g., atpF)
Grow mutants alongside wild-type controls under controlled conditions
Measure parameters at different developmental stages
Assess response to various light intensities
Correlate physiological defects with protein levels/function
For example, in I-iota mutants with atpB frameshift, researchers observed reduced ATP synthase activity (29% of wild-type), decreased chlorophyll content, altered electron transport, and increased photoinhibition . Similar approaches could be applied to study atpF mutations.
ATP synthase components play critical roles in chloroplast function and may contribute to species-specific adaptations and incompatibilities in Oenothera:
Evolutionary considerations:
Chloroplast competition:
Different chloroplast genotypes show varying competitive abilities during biparental inheritance
Genetic determinants of inheritance strength are encoded by the chloroplast genome
Association mapping identified four major regions correlating with inheritance strength:
Although not directly implicated, ATP synthase components may influence competitive fitness
Nuclear-plastid co-evolution:
ATP synthase contains subunits encoded by both plastid (e.g., atpF) and nuclear genomes (e.g., ATPG)
This requires coordinated evolution between genomes
In Chlamydomonas, the nuclear-encoded MDE1 protein (an octotricopeptide repeat protein) stabilizes atpE mRNA, illustrating nucleus/chloroplast interplay
Plastome diversity in Oenothera:
Understanding the evolutionary dynamics of ATP synthase components like atpF could provide insights into speciation mechanisms and plastid-nuclear compatibility in Oenothera.
While direct transformation of Oenothera plastids remains challenging, researchers can employ several approaches to study gene function:
Traditional genetic approaches:
Plastid exchange through controlled crosses:
Exploit biparental transmission of plastids in Oenothera
Exchange plastids between species via sexual crosses
Use permanent translocation heterozygous hybrids to maintain genetic stability
Example: Starting with AB-I and CC-II genotype-plastome combinations, create new combinations AC-I and CC-I in just two generations
Identification and characterization of natural mutations:
Modern molecular approaches:
Tobacco as a surrogate system:
In vitro systems:
While direct plastid transformation protocols for Oenothera have been reported (referenced in search result ), they are not widely used. Researchers interested in manipulating atpF specifically might consider using tobacco as a model system or exploiting natural variation through traditional breeding approaches.
Comparative analysis of atpF across Oenothera species provides insights into its evolution and function. Researchers can employ these methodological approaches:
Structural analysis:
Complete plastome sequencing:
Use primer-based strategies or next-generation sequencing
Compare atpF sequences across different plastome types
Analyze flanking regions for regulatory elements
Analysis of repetitive elements:
Expression analysis:
RT-qPCR for quantifying transcript levels:
Analysis of RNA processing:
Study intron splicing efficiency across species
Investigate 5' and 3' UTR structures
Examine post-transcriptional modifications
Protein detection methods:
Western blotting using specific antibodies
Mass spectrometry for protein identification and quantification
In-gel activity assays for functional assessment
This multi-layered approach provides comprehensive insights into atpF structure, expression, and function across Oenothera species.
Investigating protein-protein interactions involving atpF presents specific challenges due to the membrane-associated nature of ATP synthase and its multi-subunit composition:
Common challenges:
Maintaining native conformations of membrane proteins
Distinguishing direct interactions from proximity within complexes
Preserving intact complexes during isolation
Differentiating between stable and transient interactions
Methodological solutions:
Co-immunoprecipitation approaches:
Express tagged versions of atpF or interacting partners
Use mild detergents for membrane solubilization
Immunoprecipitate with tag-specific antibodies
Identify co-precipitating proteins by mass spectrometry
Perform reciprocal pull-downs to confirm interactions
In vitro reconstitution:
Express and purify individual ATP synthase components
Combine purified components under various conditions
Monitor complex assembly through analytical techniques
For membrane components, include appropriate lipids or detergents
Crosslinking strategies:
Apply chemical crosslinkers to intact chloroplasts or thylakoid membranes
Isolate ATP synthase complexes
Identify crosslinked products by mass spectrometry
Use varying crosslinker lengths to map spatial relationships
Genetic approaches:
Generate mutations in interaction domains
Assess impact on complex assembly and function
Use suppressor screening to identify compensatory mutations
Structural biology techniques:
Cryo-electron microscopy of intact ATP synthase complexes
X-ray crystallography of subcomplexes or individual components
Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces