Recombinant Oenothera elata subsp. hookeri ATP synthase subunit b, chloroplastic (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction

The recombinant Oenothera elata subsp. hookeri ATP synthase subunit b, chloroplastic (atpF) is a genetically engineered protein derived from the Fo sector of the ATP synthase complex in the chloroplasts of this plant species. ATP synthase is critical for ATP production during photosynthesis, utilizing proton gradients to drive ATP synthesis. This recombinant protein is expressed in E. coli with an N-terminal His-tag for purification and structural studies .

Amino Acid Sequence

The protein sequence of atpF includes motifs critical for proton translocation and subunit interactions:
MKNVTDSFVSLVHWPSAGSFGFNTDILATNPINLSVVLGVLIFFGKGVLSDLLDNRKQRI LNTIRNSEELREGAIEQLEKARARLQDVQIEAEGYRAYGYFGIDEQRHESINSTYKTLEQ LENNKNESIHFEQQRAINQVRQQIFQQALQGALGTLNSCLNNELHLRTISANIGLFGSMK ELTD .

Mechanistic Overview

ATP synthase in chloroplasts consists of two sectors:

  • Fo (Membrane Sector): Contains subunits a, b, c, and d, forming a proton channel.

  • F1 (Catalytic Sector): Houses subunits α, β, γ, δ, ε, and ζ, responsible for ATP synthesis .

Subunit b (atpF) is part of the Fo sector, contributing to proton translocation and structural stability. In plants, the Fo sector is distinct from bacterial homologs, with variations in heptad repeat structures and coiled-coil domains .

Research Relevance

  • Proton-Driven ATP Synthesis: The subunit facilitates proton movement across the thylakoid membrane, generating energy for ATP production .

  • Plastome Evolution: Studies on Oenothera plastomes highlight conserved genes like ycf1 and ycf2, which may interact with ATP synthase subunits in lipid metabolism and plastid inheritance .

Expression and Purification

The recombinant protein is produced in E. coli using standard protocols, with His-tag affinity chromatography enabling high-purity isolation . This system bypasses challenges in isolating native chloroplast proteins.

Potential Research Uses

ApplicationDescription
Structural StudiesInvestigating Fo-F1 interactions and proton channel dynamics .
Functional AssaysAssessing ATP synthesis efficiency in vitro using recombinant complexes .
Evolutionary AnalysesComparing plastid-encoded ATP synthase subunits across Oenothera species .

Plant vs. Bacterial Subunits

FeaturePlant (e.g., Oenothera)Bacterial (e.g., E. coli)
Sequence HomologyLow (<30%) with bacterial counterparts .High conservation across species .
Coiled-Coil DomainsExtensive heptad repeats for structural flexibility .Shorter, rigid structures in mitochondrial homologs .
Proton PathwayDistinct channel geometry due to subunit b arrangement .Well-characterized "a-subunit" proton pathway .

Key Research Findings

  1. Plastome Diversity: Complete sequencing of Oenothera plastomes revealed conserved ATP synthase subunit genes, including atpF, despite large inversions in the large single-copy (LSC) region .

  2. Lipid Metabolism Link: Mutations in accD (fatty acid biosynthesis) correlate with chloroplast inheritance strength, suggesting indirect interactions with ATP synthase function .

  3. Structural Flexibility: Bacterial subunit b dimers exhibit flexibility, whereas plant subunits may form rigid stalks, influencing energy transmission to F1 .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; ATP synthase subunit b, chloroplastic; ATP synthase F(0 sector subunit b; ATPase subunit I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-184
Protein Length
full length protein
Species
Oenothera elata subsp. hookeri (Hooker's evening primrose) (Oenothera hookeri)
Target Names
atpF
Target Protein Sequence
MKNVTDSFVSLVHWPSAGSFGFNTDILATNPINLSVVLGVLIFFGKGVLSDLLDNRKQRI LNTIRNSEELREGAIEQLEKARARLQDVQIEAEGYRAYGYFGIDEQRHESINSTYKTLEQ LENNKNESIHFEQQRAINQVRQQIFQQALQGALGTLNSCLNNELHLRTISANIGLFGSMK ELTD
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembranous catalytic F(1) domain and the membrane-bound proton channel F(0) domain, linked by a central and peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled to proton translocation via the central stalk's rotary mechanism. This protein is a component of the F(0) channel, forming part of the peripheral stalk that connects F(1) and F(0).
Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is the role of ATP synthase subunit b (atpF) in chloroplast function and biogenesis?

ATP synthase subunit b, encoded by the atpF gene, is a critical component of the peripheral stalk of chloroplast ATP synthase. According to studies on Chlamydomonas reinhardtii, this subunit works in conjunction with subunit b' (encoded by the nuclear ATPG gene) to form the peripheral stalk structure that is essential for ATP synthase assembly and stability .

The peripheral stalk serves multiple functions:

  • Connects the F₁ catalytic sector to the membrane-embedded F₀ sector

  • Provides structural stability to the entire ATP synthase complex

  • Acts as a stator to prevent rotation of the α₃β₃ catalytic center during ATP synthesis

Research has demonstrated that knockout mutations in either atpF or ATPG completely prevent ATP synthase accumulation and function, while knockdown mutations (such as those affecting the 3'UTR of ATPG) allow minimal accumulation of functional ATP synthase . This indicates that both peripheral stalk subunits are absolutely required for proper biogenesis of the chloroplast ATP synthase complex.

What methods are available for studying atpF pre-mRNA splicing in vitro?

The atpF gene contains an intron that must be spliced for proper gene expression. Researchers have developed in vitro splicing systems to study this process, particularly using tobacco chloroplast extracts. The methodology involves:

Preparation of pre-mRNA substrate:

  • Amplify the atpF gene fragment using two successive PCR reactions:

    • First PCR: Use atpF 5' primer (containing T7 promoter and part of 5' exon) and atpF 3' primer (with part of 3' exon and SacII site)

    • Second PCR: Use ApaI/T7 primer and the pre-existing 3' primer

  • Digest the PCR product with ApaI and SacII

  • Insert into the pIVS vector digested with the same enzymes

  • Linearize the circular plasmid DNA (atpF.pIVS) using NotI

  • Transcribe using T7 RNA polymerase

In vitro splicing reaction:

  • Prepare a reaction mixture containing:

    • 10 fmol atpF pre-mRNA

    • 4 μl chloroplast extract (5-15 μg protein)

    • Dithiothreitol, polyethylene glycol, glycerol, RNase inhibitor

    • 30 mM HEPES-KOH (pH 7.7)

  • Incubate for 2 hours at 28°C

  • Analyze by gel electrophoresis (spliced mRNA appears at ~340 nt, while pre-mRNA at ~1,040 nt)

This system has been optimized for studying atpF intron splicing and can be adapted for investigating factors affecting splicing efficiency.

How can researchers express and purify recombinant chloroplast ATP synthase subunits?

For expression and purification of recombinant ATP synthase subunits like atpF, researchers can follow this methodological workflow:

Expression system preparation:

  • Clone the atpF gene into an expression vector with appropriate tags (6×His, EGFP/mCherry, etc.)

  • Transform into E. coli BL21(DE3) cells for protein production

Protein expression protocol:

  • Grow transformed E. coli to mid-log phase (OD₆₀₀ = 0.5-0.7)

  • Induce protein expression with IPTG

  • Continue growth at appropriate temperature (typically 16-30°C) for 3-18 hours

  • Harvest cells by centrifugation

Purification procedure:

  • Lyse cells using appropriate buffer containing protease inhibitors

  • Clarify lysate by centrifugation

  • Perform immobilized metal affinity chromatography (IMAC) using Ni-NTA columns:

    • Equilibrate column with binding buffer

    • Apply sample under conditions favoring binding of tagged protein

    • Wash away unbound material

    • Elute the tagged protein with elution buffer containing imidazole

Quality control:

  • Analyze purified protein by SDS-PAGE

  • Verify identity by Western blotting or mass spectrometry

  • Assess functionality through appropriate enzymatic or binding assays

These methods can be adapted specifically for atpF from Oenothera elata by optimizing conditions based on the protein's properties and designing appropriate expression constructs.

How do frameshift mutations affect gene expression in chloroplast genes, and what recoding mechanisms exist?

Frameshift mutations in chloroplast genes can have profound effects on gene expression, but fascinating recoding mechanisms exist to partially correct these mutations. Studies on atpB in Oenothera provide valuable insights:

Effects of frameshift mutations:

  • Insertion or deletion mutations shift the reading frame, typically resulting in premature termination codons

  • These mutations generally lead to truncated, non-functional proteins

  • In Oenothera I-iota mutant, a single adenine insertion (+1A) in an oligoA stretch of atpB was expected to produce a truncated protein

Translational recoding mechanisms:

  • Ribosomal frameshifting can occur at specific "slippery" sequences

  • In Oenothera I-iota, full-length AtpB protein was detected despite the frameshift mutation

  • The efficiency of this recoding depends on:

    • Length and composition of the slip site (homopolymeric A stretches are particularly important)

    • Insertion of two adenines was more efficiently corrected than insertion of a single adenine

    • Deletion of one or two adenines was less efficiently corrected

Experimental approach to study recoding:

  • Generate transplastomic lines with various frameshift mutations

  • Compare plants with intact vs. disrupted oligoA stretches

  • Assess recoding efficiency through:

    • Protein detection methods (Western blotting, mass spectrometry)

    • Functional assays (ATP synthase activity measurements)

    • Physiological parameters (electron transport, photosynthetic efficiency)

This knowledge could be applied to study potential frameshift mutations and recoding mechanisms in atpF or other chloroplast genes.

What molecular marker systems are available for studying genes in Oenothera plastomes?

Several molecular marker systems have been developed specifically for Oenothera genetics, enabling researchers to distinguish individual chromosomes, entire haploid genomes (Renner complexes), plastomes, and subplastomes:

PCR-based marker systems:

  • AFLP (Amplified Fragment Length Polymorphisms):

    • Useful for distinguishing entire Renner complexes

    • Can detect polymorphisms without prior sequence knowledge

  • SSLP (Simple Sequence Length Polymorphisms):

    • Targets microsatellite regions

    • Highly polymorphic and can distinguish between closely related strains

  • CAPS (Cleaved Amplified Polymorphic Sequences):

    • Employs restriction enzyme digestion of PCR products

    • Particularly useful for distinguishing plastome types

Application example:
Researchers can monitor interspecific exchanges of genomes, chromosome pairs, and/or plastids during crossing programs by using these marker systems. This is particularly valuable when producing plastome-genome incompatible hybrids or assigning linkage groups to specific chromosomes .

For studying atpF specifically, researchers could design CAPS or SSLP markers targeting this gene region to track its inheritance or detect mutations across different Oenothera strains.

How can researchers assess the impact of mutations in ATP synthase components on photosynthetic performance?

Mutations in ATP synthase components like atpF can significantly impact photosynthetic performance. Based on studies of atpB mutations in Oenothera and tobacco, researchers can employ the following methodological approaches:

Physiological parameters to measure:

  • Chlorophyll fluorescence parameters:

    • FV/FM (maximum quantum yield of PSII)

    • qL (fraction of open PSII centers)

    • Linear electron flux measurements

    • Redox state of the PSII acceptor side

  • Spectroscopic measurements:

    • Electrochromic shift signal to assess proton conductivity (gH+)

    • P700 oxidation kinetics to evaluate PSI function

  • Biochemical analyses:

    • Chlorophyll content measurements

    • ATP synthase activity assays

    • Thylakoid membrane protein composition analysis

Experimental approach:

  • Generate plants with mutations in the gene of interest (e.g., atpF)

  • Grow mutants alongside wild-type controls under controlled conditions

  • Measure parameters at different developmental stages

  • Assess response to various light intensities

  • Correlate physiological defects with protein levels/function

For example, in I-iota mutants with atpB frameshift, researchers observed reduced ATP synthase activity (29% of wild-type), decreased chlorophyll content, altered electron transport, and increased photoinhibition . Similar approaches could be applied to study atpF mutations.

What is known about the evolutionary significance of ATP synthase components in Oenothera species?

ATP synthase components play critical roles in chloroplast function and may contribute to species-specific adaptations and incompatibilities in Oenothera:

Evolutionary considerations:

  • Chloroplast competition:

    • Different chloroplast genotypes show varying competitive abilities during biparental inheritance

    • Genetic determinants of inheritance strength are encoded by the chloroplast genome

    • Association mapping identified four major regions correlating with inheritance strength:

      • The accD gene (fatty acid biosynthesis)

      • The origin of replication B (oriB)

      • ycf1 and ycf2

    • Although not directly implicated, ATP synthase components may influence competitive fitness

  • Nuclear-plastid co-evolution:

    • ATP synthase contains subunits encoded by both plastid (e.g., atpF) and nuclear genomes (e.g., ATPG)

    • This requires coordinated evolution between genomes

    • In Chlamydomonas, the nuclear-encoded MDE1 protein (an octotricopeptide repeat protein) stabilizes atpE mRNA, illustrating nucleus/chloroplast interplay

  • Plastome diversity in Oenothera:

    • Five genetically distinguishable basic plastomes exist in subsection Oenothera

    • Complete plastome sequences reveal specific structural features, including a large inversion of ~56 kb in the LSC region

Understanding the evolutionary dynamics of ATP synthase components like atpF could provide insights into speciation mechanisms and plastid-nuclear compatibility in Oenothera.

What methods are available for genetic manipulation of plastid genes like atpF in Oenothera?

While direct transformation of Oenothera plastids remains challenging, researchers can employ several approaches to study gene function:

Traditional genetic approaches:

  • Plastid exchange through controlled crosses:

    • Exploit biparental transmission of plastids in Oenothera

    • Exchange plastids between species via sexual crosses

    • Use permanent translocation heterozygous hybrids to maintain genetic stability

    • Example: Starting with AB-I and CC-II genotype-plastome combinations, create new combinations AC-I and CC-I in just two generations

  • Identification and characterization of natural mutations:

    • Screen for plants with altered phenotypes

    • Sequence candidate genes to identify mutations

    • Example: The I-iota mutant with a frameshift in atpB

Modern molecular approaches:

  • Tobacco as a surrogate system:

    • Generate transplastomic tobacco lines carrying Oenothera gene variants

    • Use site-directed mutagenesis to introduce specific mutations

    • Analyze phenotypic effects in the tobacco background

  • In vitro systems:

    • Develop chloroplast-based in vitro systems to study specific processes

    • Example: In vitro splicing system for atpF pre-mRNA

While direct plastid transformation protocols for Oenothera have been reported (referenced in search result ), they are not widely used. Researchers interested in manipulating atpF specifically might consider using tobacco as a model system or exploiting natural variation through traditional breeding approaches.

How can researchers analyze the structure and expression of atpF across different Oenothera species and strains?

Comparative analysis of atpF across Oenothera species provides insights into its evolution and function. Researchers can employ these methodological approaches:

Structural analysis:

  • Complete plastome sequencing:

    • Use primer-based strategies or next-generation sequencing

    • Compare atpF sequences across different plastome types

    • Analyze flanking regions for regulatory elements

  • Analysis of repetitive elements:

    • Identify single sequence repeats (SSRs) in and around atpF

    • Characterize distribution and composition of repeats

    • SSRs can serve as polymorphic indicators for phylogenetic analyses

Expression analysis:

  • RT-qPCR for quantifying transcript levels:

    • Select appropriate reference genes (e.g., elongation factor 1α has shown consistent expression across Oenothera species)

    • Design gene-specific primers for atpF

    • Include appropriate controls and technical replicates

    • Analyze expression across different tissues or conditions

  • Analysis of RNA processing:

    • Study intron splicing efficiency across species

    • Investigate 5' and 3' UTR structures

    • Examine post-transcriptional modifications

  • Protein detection methods:

    • Western blotting using specific antibodies

    • Mass spectrometry for protein identification and quantification

    • In-gel activity assays for functional assessment

This multi-layered approach provides comprehensive insights into atpF structure, expression, and function across Oenothera species.

What are the challenges and solutions for studying protein-protein interactions within the ATP synthase complex?

Investigating protein-protein interactions involving atpF presents specific challenges due to the membrane-associated nature of ATP synthase and its multi-subunit composition:

Common challenges:

  • Maintaining native conformations of membrane proteins

  • Distinguishing direct interactions from proximity within complexes

  • Preserving intact complexes during isolation

  • Differentiating between stable and transient interactions

Methodological solutions:

  • Co-immunoprecipitation approaches:

    • Express tagged versions of atpF or interacting partners

    • Use mild detergents for membrane solubilization

    • Immunoprecipitate with tag-specific antibodies

    • Identify co-precipitating proteins by mass spectrometry

    • Perform reciprocal pull-downs to confirm interactions

  • In vitro reconstitution:

    • Express and purify individual ATP synthase components

    • Combine purified components under various conditions

    • Monitor complex assembly through analytical techniques

    • For membrane components, include appropriate lipids or detergents

  • Crosslinking strategies:

    • Apply chemical crosslinkers to intact chloroplasts or thylakoid membranes

    • Isolate ATP synthase complexes

    • Identify crosslinked products by mass spectrometry

    • Use varying crosslinker lengths to map spatial relationships

  • Genetic approaches:

    • Generate mutations in interaction domains

    • Assess impact on complex assembly and function

    • Use suppressor screening to identify compensatory mutations

  • Structural biology techniques:

    • Cryo-electron microscopy of intact ATP synthase complexes

    • X-ray crystallography of subcomplexes or individual components

    • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.