Recombinant Oenothera elata subsp. hookeri Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag type, please inform us for preferential development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Oenothera elata subsp. hookeri (Hooker's evening primrose) (Oenothera hookeri)
Target Names
petD
Target Protein Sequence
MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAILEPS MLGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPSGLLTVPFLENVNKF QNPFRRPVATTVFLIGTVVALWLGIGATLPIDKSLTLGLF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How does the cytochrome b6-f complex contribute to photosynthesis?

The cytochrome b6-f complex plays a central role in photosynthesis by:

  • Facilitating electron transfer between photosystem II and photosystem I in the thylakoid membrane

  • Contributing to the generation of a proton gradient across the thylakoid membrane, which drives ATP synthesis

  • Activating the state-transition kinase (STT7), which phosphorylates light-harvesting complex proteins, triggering their migration between photosystems to optimize light capture

The complex is essential for photoautotrophic growth, as evidenced by experiments showing that mutations affecting the complex's functionality inhibit the plant's ability to grow under photosynthetic conditions .

What is the importance of Oenothera as a model system for studying chloroplast genetics?

Oenothera (evening primrose) has several unique characteristics that make it an excellent model for studying chloroplast genetics and plant speciation:

  • The genus possesses a unique combination of genetic and ecological features that facilitate the study of plastome-genome interactions

  • There are five genetically distinct plastomes (I-V) that have been completely sequenced, allowing for comparative genomic studies

  • Oenothera displays non-Mendelian inheritance patterns, making it valuable for studying plastome-genome co-evolution

  • The genus shows clear phenotypic effects of plastome-genome incompatibility, particularly in photosynthetic capability, which is visible through chlorosis and other phenotypes

  • It has an extensive genetic literature and history of use dating back to the early development of plant genetics, cytogenetics, and evolutionary biology

As noted in the research: "The great advantage of using Oenothera as a model system is a large body of genetic, cytological, morphological, and ecological information collected over more than a century" .

What are the optimal methods for expressing recombinant petD protein?

Based on current research protocols, the optimal methods for expressing recombinant petD protein involve:

Vector Selection and Construction:

  • The pET-21d(+) vector system has proven effective for recombinant protein expression of chloroplast proteins similar to petD

  • For petD-specific expression, overlapping PCR methodology can be employed using gene-specific primers and appropriate vector fragments

Expression System:

  • E. coli T7 express strain has been demonstrated to be suitable for direct protein expression immediately after PCR for similar photosynthetic proteins

  • The expression can be optimized with or without 6xHistidine tags at either terminus, depending on experimental requirements

Expression Conditions:

  • Induction with IPTG at concentrations between 0.1-1.0 mM when culture reaches OD600 of 0.6-0.8

  • Post-induction growth at reduced temperature (18-25°C) for 12-16 hours improves protein folding

  • Supplementation with rare codon tRNAs may be necessary as plant chloroplast genes often contain codons rarely used in E. coli

Purification Strategy:

  • Ni-NTA affinity chromatography for His-tagged constructs following standard manual guidelines

  • Size exclusion chromatography (SEC) using a SuperdexTM200 column with buffer containing 20 mM Tris (pH 8.0) and 150 mM NaCl

  • Bradford technique can be used to determine the concentration of the purified protein

How can researchers perform site-directed mutagenesis on the petD gene for functional studies?

Researchers can employ the following methodology for site-directed mutagenesis of the petD gene:

1. Plasmid Construction:

  • Amplify the petD/trnR1 region using restriction site-containing primers (similar to those described for WT plasmid construction)

  • Clone the PCR product into a suitable vector (e.g., pUC18) using appropriate restriction enzymes

  • Incorporate a selection marker such as the aminoglycoside adenyl transferase (aadA) spectinomycin resistance cassette

2. Mutagenesis Strategy:

  • For point mutations: Use PCR-based site-directed mutagenesis with overlapping primers containing the desired mutation

  • For N-terminal modifications: Design primers that incorporate the desired changes while maintaining the reading frame

  • For larger modifications: Consider the overlapping PCR method described in the research, which requires no post-PCR modifications

3. Transformation and Selection:

  • Transform the mutated constructs into chloroplasts using biolistic transformation

  • Select transformants using spectinomycin resistance (150 μg/ml)

  • Replate resistant clones several times to obtain homoplastic strains

  • Verify mutations by sequencing

4. Functional Analysis:

  • Assess growth under various conditions, including photoautotrophic growth on TP agar plates at 25°C under different light intensities (e.g., 40 μmol photons m⁻² s⁻¹)

  • Evaluate photosynthetic parameters through optical spectroscopy

  • Analyze protein complex assembly using techniques such as Blue Native-PAGE

What techniques are most effective for studying petD protein interactions within the cytochrome b6-f complex?

Several techniques have proven effective for studying petD protein interactions:

1. Pulse-Chase Experiments:

  • This technique allows researchers to track newly synthesized proteins and assess their stability and incorporation into complexes

  • Research shows that pulse labeling for different durations (10 min vs. 30 min) can reveal differences in protein synthesis rates and stability

  • Multiple rounds of immunoprecipitation can ensure complete recovery of newly synthesized proteins

2. Size Exclusion Chromatography (SEC):

  • SEC can determine the molecular weight of recombinant PetD and assess its oligomeric state

  • Standard molecular weight markers should be used to calibrate the column

  • Optimal conditions include using a SuperdexTM200 10/300 GL column with 20 mM Tris (pH 8.0) and 150 mM NaCl at room temperature

3. Protein Modeling and Structural Analysis:

  • Homology modeling using templates such as PDB structure 2IXP

  • Programs like Phyre2 and SWISS MODEL can predict secondary structure based on sequence alignment

  • Surface conservation analysis can identify highly conserved regions that may be important for protein-protein interactions

4. State Transition Studies:
For examining cytochrome b6-f function in different photosynthetic states:

  • State 1 condition: Maintain samples in aerobic conditions by shaking in 40 μmol photons m⁻² s⁻¹ light with 10 μM DCMU

  • State 2 condition: Create anoxic treatment in the dark using a glucose oxidase/catalase cocktail

What is the role of petD in chloroplast-nuclear incompatibility in Oenothera species?

The petD protein plays a significant role in chloroplast-nuclear incompatibility in Oenothera species, particularly in the AB-I incompatibility system:

Molecular Basis of Incompatibility:

  • The psbB operon, which includes petD (encoding a core subunit of the cytochrome b6/f complex), shows light-dependent misregulation in incompatible AB-I plants

  • Research reveals that in AB-I incompatible plants, the rate of labeling of cytochrome b6/f subunits, including PetD, is greatly reduced

  • While the synthesis of Cyt b6 is not affected after 30 minutes of pulse labeling in the dac mutant, both PetD and Cyt f show significantly reduced synthesis

Physiological Consequences:

Genetic Mapping:

  • Association mapping identified four polymorphisms linked with the AB-I phenotype, including a combined 5 bp deletion/21 bp insertion in the psbM-petN spacer region

  • While the psbM/petN region may influence the incompatibility phenotype, research suggests its contribution is minor, and other chloroplast loci must be involved

Evolutionary Significance:

  • This incompatibility affects photosynthetic capability, a trait under selection in changing environments

  • It represents an important mechanism in speciation processes within the Oenothera genus

How does the N-terminal region of petD contribute to cytochrome b6-f complex assembly and function?

The N-terminal region of petD is critical for cytochrome b6-f complex assembly and function, as evidenced by recent research:

Structural Importance:

  • The N-terminal region serves as a key interaction domain for assembly with other subunits, particularly Cyt b6

  • Together with Cyt b6, PetD forms a mildly protease-resistant subcomplex that acts as a template for the assembly of additional components

Assembly Pathway:

  • PetD and Cyt b6 form an initial subcomplex

  • This subcomplex facilitates the assembly of Cyt f and PetG

  • The resulting structure forms a protease-resistant cytochrome moiety

  • PetC and PetL proteins then participate in the assembly of the functional dimer

Functional Consequences of N-terminal Alterations:

  • Mutations or alterations in the N-terminal region can severely impact the stability of the entire complex

  • Research demonstrates that when PetD is inactivated, the synthesis of Cyt f is greatly reduced, indicating that PetD is prerequisite for Cyt f synthesis and stability

  • The N-terminal region likely contains specific amino acid residues that are essential for proper folding and interaction with other subunits

Evolutionary Conservation:

  • Analysis using the PDBsum server reveals that the majority of PetD protein amino acids are extremely well conserved throughout evolutionary history

  • This high conservation underscores the critical functional importance of the protein, particularly its N-terminal domains

What are the most recent advances in understanding the regulation of petD gene expression in chloroplasts?

Recent advances in understanding petD gene expression regulation include:

Transcriptional Regulation:

  • The petD gene is part of the psbB operon, and its expression is tightly coordinated with other genes in this operon

  • 5'-RACE mapping has identified specific transcription start sites for the psbB operon, distinguishing between primary transcripts (with triphosphates at 5' ends) and processed transcripts (with monophosphates)

  • TAP (tobacco acid pyrophosphatase) transcript 5'-end mapping has been employed to precisely identify the transcription initiation sites

Post-transcriptional Processing:

  • In chloroplasts, RNA editing involving C-to-U conversions occurs at highly specific sites, though research has shown that RNA editing is not involved in the AB-I incompatibility of Oenothera

  • Analysis of chloroplast transcriptomes of O. elata (AA-I), O. biennis (AB-II), and O. grandiflora (BB-III) revealed that all compatible wild-type genome combinations share the same 45 mRNA editing sites

Translation Regulation:

  • Ribosomal loading analysis can reveal altered efficiency of translation initiation for specific RNAs

  • Shine-Dalgarno sequences, critical for translation initiation, have been predicted for chloroplast genes using the program free2bind and the 3' 16S RNA sequence of Oenothera

  • These sequences typically require a minimum free energy of 4.4 kcal and a maximum distance to the start codon of 23 bp

Experimental Approaches to Study Expression:

  • In vitro transcription using isolated chloroplasts provides insights into transcription rates

  • Slot-blot analysis with strand-specific RNA probes can detect and quantify specific transcripts

  • For studying petD specifically, researchers have used chloroplast suspensions containing 4.9 x 10⁷ chloroplasts with transcription buffer containing radiolabeled UTP

How can recombinant petD be used to study interactions between chloroplast and nuclear genomes?

Recombinant petD can serve as a powerful tool for studying chloroplast-nuclear genome interactions:

Interspecific Hybridization Studies:

  • Recombinant petD can be used to test compatibility between different nuclear backgrounds and chloroplast types

  • By introducing recombinant petD variants into different nuclear backgrounds, researchers can assess the specific contribution of petD to plastome-genome incompatibility

Structure-Function Analysis:

  • Site-directed mutagenesis of recombinant petD can identify specific residues involved in interactions with nuclear-encoded proteins

  • These experiments can pinpoint the exact molecular determinants of compatibility/incompatibility

Protein-Protein Interaction Studies:

  • Recombinant petD protein can be used in pull-down assays to identify interacting nuclear-encoded partners

  • These studies can illuminate the molecular pathways involved in coordinating chloroplast and nuclear genome expression

Evolutionary Studies:

  • Comparative analysis of petD sequences across Oenothera species can reveal patterns of co-evolution between chloroplast and nuclear genomes

  • Recombinant proteins from different species can be tested for functional compatibility, providing insights into evolutionary dynamics

Applications to Other Plant Systems:

  • Insights from Oenothera petD can be applied to understand similar processes in other plant species

  • This could lead to broader understanding of chloroplast-nuclear interactions across plant lineages

What are the challenges in producing stable and functional recombinant petD protein and how can they be overcome?

Producing stable and functional recombinant petD protein presents several challenges:

1. Membrane Protein Expression Challenges:

  • PetD is a membrane protein, which typically presents difficulties in heterologous expression

  • Solution: Use specialized expression systems like C41(DE3) or C43(DE3) E. coli strains designed for membrane protein expression

2. Protein Folding and Stability:

  • Correct folding of PetD is critical for its function and stability

  • Solution: Express at lower temperatures (16-20°C) to slow protein synthesis and improve folding; include appropriate chaperones in expression systems

3. Lack of Post-translational Modifications:

  • Bacterial systems may not provide all necessary post-translational modifications

  • Solution: Consider eukaryotic expression systems for studies requiring native modifications

4. Solubility Issues:

  • Membrane proteins often form inclusion bodies when overexpressed

  • Solution: Optimize solubilization conditions with detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin; alternatively, develop refolding protocols from inclusion bodies

5. Assembly with Partner Proteins:

  • PetD functions as part of a complex with other proteins

  • Solution: Co-express PetD with its partner proteins, particularly Cyt b6, to facilitate proper complex formation

6. Functional Assessment:

  • Confirming functionality of recombinant PetD is challenging

  • Solution: Develop reconstitution assays in liposomes or nanodiscs to test electron transfer capability

Methodological Approaches:

  • Rapid PCR-based all-recombinant cloning methodology eliminates the need for post-PCR modifications and yields only recombinant clones

  • This approach can be completed in less than 8 hours and does not require ligation of amplified DNA before transformation

  • For purification, size exclusion chromatography using a SuperdexTM200 column with appropriate buffer conditions helps maintain protein integrity

What future research directions could advance our understanding of petD's role in photosynthesis and plant adaptation?

Several promising research directions could advance our understanding of petD's role:

1. High-Resolution Structural Studies:

  • Cryo-electron microscopy of the complete cytochrome b6-f complex from Oenothera

  • X-ray crystallography of PetD in different functional states

  • These approaches would provide atomic-level insights into how PetD contributes to complex assembly and function

2. Synthetic Biology Approaches:

  • Design of synthetic petD variants with improved functionality or novel properties

  • Creation of chimeric petD genes combining elements from different species to explore compatibility determinants

  • These experiments could reveal design principles for optimizing photosynthetic efficiency

3. In Vivo Dynamics:

  • Real-time tracking of PetD assembly into the cytochrome b6-f complex in living cells

  • Analysis of how environmental factors influence complex assembly and stability

  • Such studies would provide insights into dynamic regulation of photosynthetic apparatus

4. Ecological and Evolutionary Studies:

  • Field studies examining how natural petD variants correlate with ecological adaptations

  • Comparative genomics across Oenothera populations from diverse habitats

  • This research could connect molecular function to ecological adaptation

5. Systems Biology Integration:

6. Climate Change Adaptation:

  • Investigation of how petD variants influence plant responses to increased temperatures and CO₂ levels

  • Identification of petD variants that maintain function under stress conditions

  • This research could contribute to developing climate-resilient crops

7. Translational Applications:

  • Engineering of petD to enhance photosynthetic efficiency in crop plants

  • Development of biosensors based on petD for monitoring environmental conditions

  • These applications could address challenges in sustainable agriculture

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.