Recombinant Oenothera elata subsp. hookeri Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Oenothera elata as a Model Organism

Oenothera elata, commonly known as Hooker's evening primrose or tall evening primrose, is native to western and central North America. The plant is characterized by its impressive height, with the hookeri subspecies capable of reaching approximately 1.8 meters (6 feet) . These plants typically grow along roadsides, in moist meadows, or woodland areas, ranging from sea level to elevations up to 9,000 feet (2,700 m) . The species has gained prominence in plant molecular biology research due to its unique genetic characteristics.

The evening primrose has emerged as a valuable model plant for studying organelle genetics and population biology. It is particularly well-suited for investigating mechanisms of reproductive isolation via hybrid incompatibility . The plant's distinctive genetic arrangements make it an excellent subject for research on chloroplast-nuclear interactions and the evolution of photosynthetic machinery.

Significance in Photosynthesis Research

Oenothera species have become central to research on chloroplast–nuclear incompatibility, which frequently manifests as bleached plants and occasionally as hybrid sterility or embryonic lethality. These incompatibilities predominantly affect photosynthetic capability, a trait under significant selection pressure in changing environmental conditions . The study of cytochrome b6 in this context provides valuable insights into the complex interactions between nuclear and chloroplast genomes in regulating photosynthesis.

Physical and Biochemical Properties

The recombinant form of Cytochrome b6 is typically produced as a purified protein preparation with specific storage requirements to maintain stability and activity. Based on standard protocols for similar recombinant proteins, the following properties and handling recommendations apply:

PropertySpecification
Quantity50 μg (other quantities available)
Product TypeRecombinant Protein
SpeciesOenothera elata subsp. hookeri
UniProt AccessionQ9MTJ5
Tag InformationDetermined during production process
Storage BufferTris-based buffer with 50% glycerol
Storage Conditions-20°C (or -80°C for extended storage)
Expression RegionAmino acids 1-215 (full length)
Stability NotesAvoid repeated freezing and thawing; working aliquots stable at 4°C for up to one week

These specifications ensure the protein maintains its structural integrity and functional properties for research applications .

Role in Photosynthetic Electron Transport

Cytochrome b6 is a crucial component of the cytochrome b6f complex, which serves as an essential link in the photosynthetic electron transport chain. This complex facilitates electron transfer between photosystem II and photosystem I, while simultaneously contributing to the formation of a proton gradient across the thylakoid membrane . This proton gradient is ultimately utilized by ATP synthase to generate ATP, providing energy for various cellular processes.

Recombinant Protein Production

The recombinant Oenothera elata subsp. hookeri Cytochrome b6 protein is produced using advanced biotechnological methods that allow for the expression and purification of the protein outside its native context. This process typically involves:

  1. Isolation of the gene encoding cytochrome b6 (petB) from Oenothera elata subsp. hookeri

  2. Insertion of the gene into an appropriate expression vector

  3. Introduction of the vector into a host organism (commonly bacteria, yeast, or mammalian cells)

  4. Induction of protein expression under controlled conditions

  5. Harvesting and purification of the recombinant protein

  6. Quality assessment and characterization of the purified protein

The resulting recombinant protein provides a valuable tool for various research applications, offering advantages over native protein isolation in terms of yield, purity, and consistency.

Research Applications

Recombinant Oenothera elata subsp. hookeri Cytochrome b6 has numerous applications in scientific research:

  1. Structural studies: The purified protein can be used for crystallography or other structural determination methods to elucidate the three-dimensional structure of cytochrome b6.

  2. Functional analysis: Recombinant cytochrome b6 allows for in vitro studies of electron transport mechanisms and interactions with other components of the photosynthetic machinery.

  3. Antibody production: The protein serves as an antigen for generating specific antibodies that can be used for detection and localization studies.

  4. Enzyme-linked immunosorbent assays (ELISA): The recombinant protein can be employed in ELISA-based detection systems for various research purposes .

  5. Comparative analyses: Researchers can perform comparative studies between cytochrome b6 variants from different plant species or under different environmental conditions.

Hybrid Incompatibility in Oenothera

Oenothera species exhibit interesting patterns of chloroplast-nuclear incompatibility in hybrid offspring. These incompatibilities frequently result in bleached plants, and in rare cases, lead to hybrid sterility or embryonic lethality . Since most of these incompatibilities affect photosynthetic capability, components of the photosynthetic machinery—including cytochrome b6—play crucial roles in these phenomena.

The psbB Operon and Photosynthetic Function

Research has shown that light-dependent misregulation of the plastid psbB operon, which encodes core subunits of photosystem II and the cytochrome b6f complex (including the petB gene), is associated with hybrid incompatibility in Oenothera . The study of recombinant cytochrome b6 contributes to our understanding of these complex interactions between nuclear and chloroplast genomes in regulating photosynthesis.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Oenothera elata subsp. hookeri (Hooker's evening primrose) (Oenothera hookeri)
Target Names
petB
Target Protein Sequence
MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome b6 (petB) and what is its biological significance?

Cytochrome b6 is a crucial component of the cytochrome b6-f complex involved in photosynthetic electron transport. In Oenothera elata subsp. hookeri (Hooker's evening primrose), this protein plays an essential role in transferring electrons between photosystem II and photosystem I during photosynthesis . The petB gene encodes this protein, which contains 215 amino acids in its full-length form .

The biological significance of this protein lies in its central position in the photosynthetic electron transport chain, making it critical for energy conversion in plants. Understanding its structure and function provides valuable insights into fundamental photosynthetic mechanisms and potentially informs strategies for improving plant productivity.

How does Oenothera elata Cytochrome b6 compare structurally with homologs from other species?

Cytochrome b6 shows high sequence conservation across plant species, reflecting its essential role in photosynthesis. Comparative sequence analysis reveals:

SpeciesUniProt IDSequence Identity (%)Notable Differences
Arabidopsis thalianaNP_051088.1~95Minor variations in transmembrane domains
Oryza sativaNP_039415.1~90Differences in stromal loop regions
Nicotiana tabacumP06247.2~93Variations in quinone binding sites
Spinacia oleraceaNP_054964.1~94Conservative substitutions throughout

These similarities enable researchers to apply findings across species while accounting for specific structural differences that may influence function or experimental handling . When designing experiments, consider that the highest variability typically occurs in loop regions rather than in the core transmembrane helices.

What expression systems are most effective for producing recombinant Cytochrome b6 from Oenothera elata?

The most effective expression system for recombinant Cytochrome b6 from Oenothera elata is Escherichia coli, with several specific approaches yielding optimal results:

  • E. coli BL21(DE3) with pET expression vectors (particularly pET-28a) provides high expression levels under IPTG induction .

  • Optimization strategies:

    • Using the codon-optimized sequence for E. coli dramatically improves expression

    • Including a His-tag (typically N-terminal) facilitates purification

    • Expression at lower temperatures (16-20°C) after induction improves proper folding

    • Supplementing growth media with heme precursors enhances cofactor incorporation

For advanced applications requiring post-translational modifications, alternative systems such as yeast or baculovirus expression systems may be considered, though with typically lower yields than E. coli .

What are the critical factors for successful purification of recombinant Cytochrome b6?

Successful purification of recombinant Cytochrome b6 requires addressing several critical challenges:

  • Membrane protein solubilization:

    • Use mild detergents (DDM, LDAO, or C12E8) at concentrations just above CMC

    • Include glycerol (10-20%) to enhance stability during extraction

    • Maintain low temperature (4°C) throughout the process

  • Affinity chromatography:

    • Ni-NTA chromatography for His-tagged proteins with imidazole gradient elution

    • Use buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, and detergent below CMC

  • Additional purification steps:

    • Size exclusion chromatography to separate monomeric protein from aggregates

    • Ion exchange chromatography for removal of E. coli contaminants

  • Quality assessment:

    • SDS-PAGE analysis (≥85% purity standard for most applications)

    • Spectroscopic analysis to confirm proper heme incorporation

    • Mass spectrometry to verify intact protein mass

Researchers should monitor protein stability throughout the purification process and minimize exposure to air, light, and elevated temperatures.

How can researchers optimize protein yield when expressing Cytochrome b6 in E. coli?

Optimizing recombinant Cytochrome b6 yield requires systematic adjustment of expression conditions:

  • Vector design improvements:

    • Implement enhanced Shine-Dalgarno sequences for stronger ribosome binding

    • Optimize the spacing between SD sequence and start codon (8±2 nucleotides)

    • Consider using improved pET vector designs with optimized transcription and translation control elements

  • Expression conditions optimization:

    • Test induction at varying OD600 values (0.6-1.0 typically optimal)

    • Evaluate different IPTG concentrations (0.1-1.0 mM)

    • Perform expression at reduced temperatures (16-25°C) for 16-24 hours

    • Use enriched media (TB or 2YT) supplemented with appropriate cofactors

  • Co-expression strategies:

    • Co-express with chaperones (GroEL/GroES) to improve folding

    • Consider co-expression with heme biosynthesis enzymes

Experimental data from comparative expression trials indicates that lowering the temperature to 18°C after induction and extending expression time to 18-20 hours can increase yield 2-3 fold compared to standard conditions (37°C for 4 hours) .

What spectroscopic methods are most informative for analyzing Cytochrome b6 structure and function?

Several spectroscopic methods provide critical insights into Cytochrome b6 structure and function:

  • UV-Visible Absorption Spectroscopy:

    • Measures characteristic absorption peaks at ~414 nm (Soret band) and ~553 nm (α-band)

    • Can distinguish between oxidized and reduced states

    • Methodology: Record spectra in 20 mM Tris buffer (pH 7.5) containing appropriate detergent; compare spectra before and after addition of reducing agents (sodium dithionite)

  • Circular Dichroism (CD) Spectroscopy:

    • Provides information about secondary structure elements

    • Far-UV CD (190-250 nm) reveals α-helical content (characteristic minima at 208 and 222 nm)

    • Near-UV CD (250-320 nm) provides tertiary structure fingerprint

  • Electron Paramagnetic Resonance (EPR):

    • Detects paramagnetic centers, particularly useful for studying heme environment

    • Requires samples at 77K or lower in appropriate EPR tubes

    • Provides information about the coordination state of heme iron

  • Resonance Raman Spectroscopy:

    • Identifies specific vibrational modes of the heme group

    • Requires excitation at wavelengths corresponding to electronic transitions (typically ~400-450 nm)

    • Provides information about heme-protein interactions and structural changes during redox reactions

These methods should be used complementarily to gain comprehensive structural and functional insights.

How can researchers effectively assess the electron transport activity of purified Cytochrome b6?

Assessing the electron transport activity of purified Cytochrome b6 requires specialized assays that mimic its native function:

  • Cytochrome c reduction assay:

    • Measures the rate of cytochrome c reduction as an indicator of electron transfer capability

    • Reaction mixture: 50 mM phosphate buffer (pH 7.4), 50 μM cytochrome c, appropriate electron donors (e.g., reduced plastoquinone analogs)

    • Monitor absorbance change at 550 nm over time

    • Calculate activity as μmol cytochrome c reduced per minute per mg protein

  • Oxygen consumption measurements:

    • Uses Clark-type oxygen electrodes to measure oxygen consumption coupled to electron transport

    • Requires reconstitution of Cytochrome b6 with other components of the electron transport chain

    • Provides functional data in a more complete system

  • Artificial electron acceptor/donor systems:

    • Employ artificial electron acceptors like ferricyanide or DCPIP

    • Allow measurement of specific electron transfer steps

    • Useful for comparing mutant proteins or different preparation methods

Activity measurements should be performed at controlled temperature (typically 25°C) and under anaerobic conditions when possible to prevent interference from oxygen.

What approaches are most effective for studying the interaction of Cytochrome b6 with other components of the electron transport chain?

Studying Cytochrome b6 interactions with other electron transport chain components requires specialized approaches:

  • Proteoliposome reconstitution:

    • Co-reconstitute purified Cytochrome b6 with purified interaction partners in liposomes

    • Use defined lipid compositions (e.g., DOPC/DOPE/DOPG mixtures)

    • Measure functional parameters like electron transfer rates or proton pumping

  • Surface Plasmon Resonance (SPR):

    • Immobilize Cytochrome b6 or its partner protein on sensor chips

    • Measure real-time binding kinetics and determine affinity constants

    • Requires careful optimization of detergent conditions to maintain native structure

  • Cross-linking coupled with mass spectrometry:

    • Use chemical cross-linkers of defined length to capture transient interactions

    • Identify cross-linked peptides by mass spectrometry

    • Map interaction interfaces at amino acid resolution

  • Cryo-electron microscopy:

    • Visualize the entire cytochrome b6-f complex structure

    • Provides structural context for understanding functional interactions

    • Requires advanced sample preparation and high-end equipment

Each approach provides complementary information, and multiple methods should be employed for comprehensive characterization of protein-protein interactions.

How can site-directed mutagenesis be applied to study structure-function relationships in Cytochrome b6?

Site-directed mutagenesis offers powerful insights into Cytochrome b6 structure-function relationships:

  • Strategic mutation design:

    • Target conserved residues identified through sequence alignments across species

    • Focus on heme-coordinating histidines (essential for function)

    • Investigate quinone-binding pocket residues

    • Examine potential proton transfer pathways

  • Recommended mutation types:

    • Conservative substitutions (e.g., Leu→Ile) to study subtle structural effects

    • Charge reversals (e.g., Asp→Lys) to investigate electrostatic interactions

    • Cysteine substitutions for subsequent labeling studies

  • Experimental workflow:

    • Use overlap extension PCR or commercial mutagenesis kits

    • Verify mutations by sequencing

    • Express and purify mutant proteins under identical conditions as wild-type

    • Perform comparative functional assays (electron transfer rates, spectroscopic properties)

  • Structure-function correlation:

    • Map mutations onto available structural models

    • Correlate functional defects with structural perturbations

    • Use molecular dynamics simulations to predict effects of mutations on protein dynamics

This approach has successfully identified key residues involved in quinone binding and electron transfer pathways in related cytochrome complexes.

What challenges exist in determining the high-resolution structure of Cytochrome b6, and how can they be addressed?

Determining the high-resolution structure of Cytochrome b6 faces several challenges:

  • Membrane protein crystallization barriers:

    • Hydrophobic surfaces limit crystal contacts

    • Detergent micelles complicate crystallization

    • Solutions:

      • Screen diverse detergents (DDM, LDAO, OG) and detergent-lipid mixtures

      • Try lipidic cubic phase crystallization

      • Employ fusion proteins (e.g., T4 lysozyme) to provide crystal contacts

  • Conformational heterogeneity:

    • Multiple functional states complicate structural analysis

    • Solutions:

      • Use inhibitors to lock specific conformations

      • Employ nanobodies to stabilize conformations

      • Analyze with computational classification methods

  • Cryo-EM alternatives:

    • Single-particle cryo-EM can resolve structures without crystallization

    • Required steps:

      • Optimize sample vitrification conditions

      • Use Volta phase plates to enhance contrast

      • Apply extensive computational sorting for heterogeneous samples

  • Integrative structural biology approach:

    • Combine lower-resolution techniques (SAXS, cryo-EM) with high-resolution data from X-ray crystallography

    • Validate structures using spectroscopic methods (EPR, FTIR)

    • Perform molecular dynamics simulations to study dynamics

These approaches have proven effective for related membrane proteins in the photosynthetic electron transport chain.

How can recombinant Cytochrome b6 be utilized to study the evolution of photosynthetic systems?

Recombinant Cytochrome b6 provides valuable tools for evolutionary studies of photosynthesis:

  • Comparative biochemical analysis:

    • Express and purify Cytochrome b6 from diverse photosynthetic organisms

    • Compare kinetic parameters, redox potentials, and spectroscopic properties

    • Correlate functional differences with evolutionary adaptations to specific environmental niches

  • Ancestral sequence reconstruction:

    • Infer ancestral Cytochrome b6 sequences using phylogenetic methods

    • Express and characterize these reconstructed proteins

    • Trace the evolutionary trajectory of functional properties

  • Horizontal gene transfer investigation:

    • Compare Cytochrome b6 sequences across taxonomic boundaries

    • Identify potential horizontal gene transfer events

    • Express proteins from different lineages to assess functional conservation

  • Experimental evolution approach:

    • Create libraries of Cytochrome b6 variants through directed evolution

    • Select for specific functions under defined conditions

    • Compare evolutionary pathways with natural sequence diversity

These approaches provide insights into how photosynthetic electron transport chains evolved and adapted to diverse environmental conditions, potentially informing both basic science understanding and biotechnological applications.

What are the optimal storage conditions for maintaining the stability and activity of purified recombinant Cytochrome b6?

Optimal storage conditions for purified recombinant Cytochrome b6 are critical for maintaining its stability and activity:

  • Buffer composition:

    • Tris-based buffer (50 mM, pH 8.0) containing 50% glycerol

    • Include appropriate detergent at concentrations just above CMC

    • Add reducing agent (1-5 mM DTT or 2-mercaptoethanol) to prevent oxidative damage

    • Consider adding protease inhibitors for long-term storage

  • Temperature considerations:

    • Short-term storage (1 week): 4°C

    • Medium-term storage (1-3 months): -20°C

    • Long-term storage (>3 months): -80°C

    • Avoid repeated freeze-thaw cycles (aliquot before freezing)

  • Physical conditions:

    • Store in dark conditions to prevent light-induced damage to heme groups

    • Use air-tight containers to prevent oxidation

    • Consider storing under nitrogen or argon atmosphere for maximum stability

  • Quality control protocols:

    • Periodically check activity using standardized assays

    • Monitor spectral properties to detect denaturation or heme loss

    • Use gel electrophoresis to check for degradation

Following these guidelines can maintain protein activity for 6-12 months, depending on storage conditions and protein preparation quality .

What methods can be used to reconstitute Cytochrome b6 into membrane systems for functional studies?

Reconstituting Cytochrome b6 into membrane systems requires careful methodology:

  • Liposome reconstitution protocol:

    • Prepare lipid mixture (typically DOPC:DOPE:DOPG at 7:2:1 ratio)

    • Create unilamellar vesicles by extrusion through polycarbonate filters

    • Add detergent-solubilized protein to liposomes at defined protein:lipid ratios

    • Remove detergent using Bio-Beads SM-2 or gradual dilution

    • Verify incorporation by sucrose gradient centrifugation

  • Nanodiscs incorporation:

    • Mix protein, appropriate lipids, and membrane scaffold proteins

    • Remove detergent through dialysis or adsorption

    • Purify protein-containing nanodiscs by size exclusion chromatography

    • Characterize size and homogeneity by dynamic light scattering

  • Proteoliposome fusion with planar bilayers:

    • Form planar lipid bilayers across apertures in Teflon partitions

    • Induce fusion of protein-containing proteoliposomes

    • Measure electrical properties using voltage-clamp techniques

  • Quality assessment:

    • Measure protein:lipid ratio by phosphate and protein assays

    • Check orientation using protease accessibility tests

    • Verify functionality through electron transport or spectroscopic assays

These reconstitution systems allow investigation of Cytochrome b6 in environments that more closely mimic its native membrane context.

What strategies can address low expression yields of recombinant Cytochrome b6?

When facing low expression yields of recombinant Cytochrome b6, researchers should implement the following troubleshooting strategies:

  • Optimize codon usage:

    • Analyze the codon adaptation index (CAI) of the native sequence

    • Synthesize a codon-optimized gene for E. coli expression

    • Consider rare codon analysis and supplement with appropriate tRNA plasmids

  • Adjust expression conditions:

    • Test multiple E. coli strains (BL21(DE3), C41(DE3), C43(DE3), Rosetta)

    • Reduce expression temperature to 16-20°C

    • Try auto-induction media instead of IPTG induction

    • Vary induction time and harvesting points

  • Modify protein construct:

    • Remove problematic regions like flexible loops

    • Add solubility-enhancing fusion partners (MBP, SUMO, thioredoxin)

    • Try both N- and C-terminal tag placements

  • Implement specialized protocols:

    • Use molecular chaperone co-expression (GroEL/GroES, DnaK/DnaJ)

    • Supplement growth media with heme precursors (δ-aminolevulinic acid)

    • Test periplasmic expression strategies with appropriate signal sequences

Systematic testing of these variables and careful documentation of results often identifies conditions that significantly improve expression yields .

How can researchers troubleshoot problems with protein misfolding and aggregation during purification?

Addressing protein misfolding and aggregation during Cytochrome b6 purification requires systematic troubleshooting:

  • Optimize solubilization conditions:

    • Screen multiple detergent types at various concentrations

    • Test mixed detergent systems (e.g., DDM with CHS)

    • Add stabilizing agents (glycerol, sucrose, specific lipids)

    • Adjust pH and ionic strength of extraction buffers

  • Modify purification protocols:

    • Include reducing agents throughout purification

    • Maintain low temperature (4°C) during all steps

    • Add specific ligands or substrates that stabilize the native conformation

    • Consider on-column refolding approaches

  • Implement quality control steps:

    • Use analytical size exclusion chromatography to monitor aggregation state

    • Apply dynamic light scattering to detect early aggregation

    • Perform thermal stability assays (DSF) to identify stabilizing conditions

    • Include an ultracentrifugation step before final purification

  • Apply rescue strategies for aggregated protein:

    • Test mild solubilization with sarcosyl followed by exchange to milder detergents

    • Implement on-column refolding protocols

    • Explore chemical chaperones (arginine, proline) in purification buffers

These approaches have successfully resolved aggregation issues with other membrane proteins from the photosynthetic electron transport chain.

How does Cytochrome b6 from Oenothera elata compare functionally with equivalent proteins from cyanobacteria and algae?

Comparative functional analysis reveals important differences between Cytochrome b6 from Oenothera elata and its counterparts in cyanobacteria and algae:

CharacteristicOenothera elata (Plant)CyanobacteriaGreen Algae
Redox potential (heme b₆)-50 to -100 mV-10 to -40 mV-30 to -70 mV
Electron transfer rateModerateFasterIntermediate
Inhibitor sensitivityHigh sensitivity to DBMIBLower sensitivityIntermediate
Lipid requirementsRequires SQDG and PGLess specificRequires DGDG
Post-translational modificationsMultipleMinimalIntermediate

These differences reflect evolutionary adaptations to different photosynthetic environments and cellular organizations. Key experimental approaches for comparative studies include:

  • Recombinant expression of proteins from diverse organisms under identical conditions

  • Parallel purification and reconstitution protocols

  • Standardized activity assays to enable direct comparison

  • Spectroscopic analysis to identify structural differences affecting function

This comparative approach provides insights into the evolution of photosynthetic electron transport and identifies structural features that could be targeted for engineering improved photosynthetic efficiency.

What research applications benefit from using recombinant Cytochrome b6 versus native protein purified from plant material?

Using recombinant Cytochrome b6 offers several advantages over native protein for specific research applications:

  • Structural studies benefits:

    • Introduction of specific affinity tags facilitates purification and crystallization

    • Site-directed mutagenesis enables investigation of structure-function relationships

    • Isotopic labeling for NMR studies is feasible with recombinant systems

    • Expression levels can be optimized to obtain quantities needed for structural biology

  • Functional studies advantages:

    • Precisely controlled protein composition eliminates contaminants

    • Ability to generate multiple variants with specific mutations

    • Higher yield enables high-throughput screening approaches

    • Consistent batch-to-batch preparation quality

  • Specific applications where recombinant protein is superior:

    • Antibody production requiring high purity antigen

    • In vitro reconstitution of electron transport systems

    • Binding studies with defined stoichiometry

    • Synthetic biology applications requiring well-defined components

  • Cases where native protein may be preferred:

    • Studies requiring authentic post-translational modifications

    • Investigations of native protein-protein interactions within the complex

    • Research focused on physiological regulation in planta

The choice between recombinant and native protein should be guided by the specific research questions being addressed and the experimental approaches required .

What emerging technologies might advance our understanding of Cytochrome b6 structure and function?

Several emerging technologies show promise for advancing Cytochrome b6 research:

  • Cryo-electron tomography:

    • Enables visualization of Cytochrome b6 in its native membrane environment

    • Provides insights into supramolecular organization of photosynthetic complexes

    • Resolves structural heterogeneity present in native systems

  • Time-resolved spectroscopy and structural methods:

    • Femtosecond X-ray free electron laser (XFEL) crystallography captures transient states

    • Time-resolved cryo-EM visualizes conformational changes during function

    • Ultrafast spectroscopy tracks electron movement through the complex

  • Integrative structural biology approaches:

    • Combines data from multiple experimental techniques (crystallography, cryo-EM, spectroscopy)

    • Incorporates computational modeling and molecular dynamics simulations

    • Provides more complete picture of structure-function relationships

  • Single-molecule techniques:

    • Fluorescence resonance energy transfer (FRET) to track conformational changes

    • Single-molecule force spectroscopy to probe stability and unfolding pathways

    • Correlative light and electron microscopy for in situ visualization

These technologies promise to resolve long-standing questions about the mechanism of proton-coupled electron transfer and could inform strategies for engineering enhanced photosynthetic efficiency.

How might artificial intelligence and computational methods enhance research on Cytochrome b6?

Artificial intelligence and computational methods are transforming Cytochrome b6 research through several approaches:

  • Protein structure prediction and refinement:

    • AlphaFold2 and RoseTTAFold provide accurate structural models even with limited experimental data

    • Molecular dynamics refinement improves predicted structures

    • Integration with experimental data enhances model quality

  • Machine learning for functional prediction:

    • Identification of functional residues from sequence patterns

    • Prediction of electron transfer pathways

    • Classification of variants by likely functional impact

  • Molecular simulation advancements:

    • Quantum mechanics/molecular mechanics (QM/MM) simulations of electron transfer

    • Enhanced sampling techniques to access functionally relevant timescales

    • Multi-scale modeling connecting molecular events to physiological outcomes

  • Data integration platforms:

    • Automated literature mining for hypothesis generation

    • Integration of diverse experimental datasets

    • Network analysis of protein-protein interactions in photosynthetic complexes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.