Recombinant Oenothera elata subsp. hookeri Cytochrome c biogenesis protein ccsA (ccsA)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs to the best of our ability.
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: Our proteins are shipped standard with blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Note: Our proteins are shipped standard with blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference point.
Shelf Life
Shelf life is dependent on several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you have specific tag type requirements, please communicate them to us. We will prioritize developing the specified tag when possible.
Synonyms
ccsA; Cytochrome c biogenesis protein CcsA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Oenothera elata subsp. hookeri (Hooker's evening primrose) (Oenothera hookeri)
Target Names
ccsA
Target Protein Sequence
MIFYTLEHILTHISFSLVSIGITIFLITLSVDEIIGLYDSSEKGVIGTFLCITGLLVTRW
AYSGHFPLSNLYESLLFLSWSFAIIHMFPYFKKQKSYVRTITSSSTIFTQGLVTSGLLSE
MQQSEILVPALQSQWLMMHVSMMVLGYAALLCGSLLSVALLVITFRKALRIFSKKKAFLK
DSFSFVEIQYRNEPSNVLLSTSFISSKNYYRAQLIQQLDRWSSRIISLGFIFLTIGILSG
AVWANEAWGSYWNWDPKETWAFITWTMFAIYLHTRTNPNFQSVNSAIVAFLGFIIIWICY
FGVNLLGIGLHSYGSFNLH
Uniprot No.
Target Background
Function
This protein plays a crucial role in the biogenesis of c-type cytochromes (cytochrome c6 and cytochrome f) during the heme attachment step.
Protein Families
CcmF/CycK/Ccl1/NrfE/CcsA family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
