Recombinant Oenothera elata subsp. hookeri NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)

What is NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) and what is its function in Oenothera elata?

NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) is a chloroplastic protein that functions as part of the NDH complex in the photosynthetic electron transport chain. In Oenothera elata subsp. hookeri (Hooker's evening primrose), this protein plays a critical role in cyclic electron flow around Photosystem I, contributing to ATP synthesis without concurrent NADPH production. The protein facilitates electron transfer from NAD(P)H to plastoquinone, which is essential for optimizing the ATP/NADPH ratio during photosynthesis under varying environmental conditions. The ndhC subunit specifically contributes to the membrane domain of the NDH complex and is encoded by the chloroplast genome .

What is the molecular structure of recombinant ndhC from Oenothera elata?

The recombinant ndhC from Oenothera elata subsp. hookeri consists of 120 amino acid residues with a sequence beginning with "MFLLYEYDIFWAFLIISSVIPILAFRISGLLAPTSIGPEKLSSYESGIEPMGDAWLQFRIRYYMFALVFVVFDVETIFLYPWALSFDILGVSVFIEALIFVLILVLGLVYAWRKGALEWS" . The protein has a molecular weight of approximately 13-14 kDa. Structurally, ndhC is a hydrophobic membrane protein with multiple transmembrane domains, which enables its role in the thylakoid membrane of chloroplasts. The protein contains regions that participate in quinone binding and interaction with other subunits of the NDH complex. When expressed recombinantly, the protein may include additional tag sequences for purification purposes, depending on the expression system used .

How does ndhC from Oenothera elata differ from other plant species?

While the core function of ndhC is conserved across photosynthetic organisms, there are species-specific variations in sequence and structure that can affect protein-protein interactions and enzymatic efficiency. The Oenothera elata subsp. hookeri ndhC (UniProt ID: Q9MTP5) shows high sequence conservation in functional domains compared to other plant species, but contains unique amino acid substitutions that may contribute to the adaptation of this evening primrose species to its ecological niche . These differences can manifest in altered binding affinities for electron carriers, stability under various environmental conditions, and integration efficiency into the NDH complex. Comparative analysis with ndhC from model plants like Arabidopsis thaliana and crop species can provide insights into the evolutionary divergence of photosynthetic machinery across the plant kingdom.

What are the challenges in expressing and purifying functional recombinant ndhC protein?

Expressing and purifying functional recombinant ndhC presents several significant challenges due to its inherent properties. As a hydrophobic membrane protein, ndhC tends to form insoluble aggregates when overexpressed in typical bacterial systems like E. coli. Researchers must optimize multiple parameters simultaneously to achieve successful expression of soluble, functional protein. Key challenges include:

• Protein solubility: Optimization of growth temperature (typically reduced to 28-30°C), inducer concentration (with lower IPTG concentrations often yielding better results), and post-induction incubation time are critical factors .

• Membrane integration: Since ndhC is naturally integrated into thylakoid membranes, recombinant expression systems must account for proper membrane targeting or provide suitable detergents for maintaining solubility.

• Maintaining protein folding: The use of fusion tags like SUMO can significantly enhance solubility and proper folding, though subsequent tag removal must be optimized to preserve native protein structure .

• Purification complexity: Multi-step purification procedures are typically required, often incorporating affinity chromatography with polyhistidine tags followed by size exclusion or ion exchange chromatography to achieve high purity.

Research indicates that a design of experiments (DoE) approach is more efficient than traditional one-factor-at-a-time optimization methods, as it can account for interaction effects between multiple parameters .

How can researchers optimize recombinant ndhC expression using Design of Experiments (DoE) approaches?

Design of Experiments (DoE) provides a systematic framework for optimizing recombinant ndhC expression by evaluating multiple parameters simultaneously. Based on current research methodologies:

• Factorial design implementation: A multi-factorial experimental design (e.g., 2×4×7 design) examining temperature (28°C, 37°C), inducer concentration (0 mM, 0.01 mM, 0.1 mM, 1 mM IPTG), and post-induction time (1-18 hours) would provide comprehensive data on optimal expression conditions .

• Response surface methodology (RSM): After identifying significant factors, RSM can model the relationship between variables and protein yield/solubility, generating mathematical models to predict optimal conditions.

• Software-assisted analysis: Several software packages can facilitate DoE approach selection, experimental design, and result analysis, reducing cost and time investments .

What are the functional assay methods for verifying the activity of recombinant ndhC protein?

Verifying the functional activity of recombinant ndhC requires specialized assays that assess its role in electron transport. Established methodologies include:

• Electron transport measurements: Using artificial electron donors and acceptors to measure the rate of electron transfer through purified ndhC or reconstituted NDH complexes. Typical assays monitor the reduction of various quinone analogs (e.g., decylubiquinone) spectrophotometrically.

• Reconstitution studies: Incorporating purified recombinant ndhC into proteoliposomes or nanodiscs to recreate a membrane environment, followed by functional assays to measure electron transport capability.

• Complementation assays: Expressing recombinant ndhC in mutant organisms lacking functional ndhC to assess restoration of photosynthetic efficiency.

• Binding assays: Evaluating interaction with other NDH complex subunits or substrates using techniques such as isothermal titration calorimetry (ITC), surface plasmon resonance (SPR), or microscale thermophoresis (MST).

• EPR spectroscopy: Examining electron transfer through the protein by detecting changes in paramagnetic species during catalytic turnover.

Researchers should validate activity under different physiological conditions (pH, temperature, ionic strength) to characterize the protein's functional properties comprehensively.

What expression systems are most suitable for producing recombinant ndhC protein?

Several expression systems can be employed for recombinant ndhC production, each with distinct advantages depending on research objectives:

For ndhC, E. coli remains the most commonly used system due to its accessibility, though special considerations are needed for membrane protein expression. Using specialized E. coli strains (C41/C43) designed for membrane protein expression or fusion tags (SUMO, MBP, Trx) significantly improves success rates . The expression system should be selected based on downstream applications—structural studies may require higher purity and native conformation, while functional assays might tolerate lower purity but require proper folding.

What purification strategy provides the highest yield of functional ndhC protein?

A multi-step purification strategy optimized for membrane proteins is essential for obtaining high-yield functional ndhC:

• Initial membrane preparation: After cell lysis, differential centrifugation is used to isolate membrane fractions containing ndhC.

• Solubilization: Gentle detergents such as n-dodecyl-β-D-maltoside (DDM), LDAO, or digitonin are used to extract ndhC from membranes while maintaining native structure.

• Affinity chromatography: Utilizing engineered tags (His6, SUMO, etc.) for initial capture purification:

  • His-tag based purification on IMAC columns (Ni-NTA or Co-based resins) with imidazole gradients for elution

  • Alternative tag systems for proteins without His-tags

• Tag removal: For proteins with cleavable tags, controlled proteolysis using specific proteases (e.g., SUMO protease) followed by reverse affinity chromatography to separate the tag .

• Secondary purification: Size-exclusion chromatography to separate monomeric protein from aggregates and increase purity.

• Concentration and buffer exchange: Using specialized membrane protein concentrators with appropriate molecular weight cutoffs.

Optimization data from similar membrane proteins suggests that utilizing 0.1 mM IPTG at 37°C with 5-hour post-induction incubation provides the highest yield of soluble protein . The solubilized protein should be maintained in detergent-containing buffers throughout purification to prevent aggregation, with typical yields of purified ndhC reaching 200-500 μg/mL after optimization.

How should researchers design experiments to investigate ndhC interactions with other NDH complex components?

Designing experiments to investigate ndhC interactions with other NDH complex components requires systematic approaches focusing on both physical and functional interactions:

• Co-immunoprecipitation studies:

  • Using antibodies against ndhC or epitope tags to pull down interaction partners

  • Mass spectrometry analysis of co-precipitated proteins to identify novel interactions

  • Reciprocal experiments with antibodies against suspected interaction partners

• Yeast two-hybrid or split-ubiquitin assays:

  • Modified membrane-based Y2H systems to identify direct protein-protein interactions

  • Mapping interaction domains through truncation or point mutation analysis

• Surface plasmon resonance (SPR) or bio-layer interferometry (BLI):

  • Quantitative measurement of binding kinetics between purified ndhC and partner proteins

  • Determination of dissociation constants (Kd) under varying conditions

• Reconstitution experiments:

  • Systematic assembly of partial complexes with purified components

  • Activity assays to determine functional consequences of specific interactions

• Cryo-EM or X-ray crystallography:

  • Structural determination of ndhC alone or in complex with interaction partners

  • Identification of critical contact residues and binding interfaces

How should researchers interpret contradictory data in ndhC functional studies?

When confronted with contradictory data in ndhC functional studies, researchers should implement a systematic approach to resolve discrepancies:

• Methodological comparison: Analyze differences in experimental methods that might explain contradictory results, including:

  • Expression system variations (E. coli strains, growth conditions, induction parameters)

  • Purification protocols (detergent types, buffer compositions, purification strategies)

  • Assay conditions (temperature, pH, substrate concentrations, detection methods)

• Protein state assessment: Evaluate whether contradictions stem from differences in protein conformation or aggregation state:

  • Conduct size exclusion chromatography to confirm monodispersity

  • Employ circular dichroism to assess secondary structure integrity

  • Use differential scanning fluorimetry to compare thermal stability between preparations

• Post-translational modification analysis: Investigate whether differences in post-translational modifications affect function:

  • Use mass spectrometry to identify and quantify modifications

  • Generate site-directed mutants to assess the impact of specific modifications

• Integration level consideration: Determine whether contradictions arise from studying the protein at different levels of integration:

  • Isolated protein versus membrane-embedded protein

  • Single subunit versus complete NDH complex

  • In vitro versus in vivo systems

• Mathematical modeling: Develop kinetic or thermodynamic models that might accommodate seemingly contradictory observations within a unified theoretical framework.

When publishing results, researchers should explicitly address contradictions with previous literature, proposing testable hypotheses to resolve discrepancies rather than simply highlighting differences.

What statistical approaches are most appropriate for analyzing ndhC expression optimization data?

Statistical approaches for analyzing ndhC expression optimization data should be tailored to the experimental design and account for the complexities of recombinant protein production:

• Design of Experiments (DoE) statistical methods:

  • Analysis of Variance (ANOVA) for multi-factorial designs to identify significant factors and interactions

  • Response Surface Methodology (RSM) to model nonlinear relationships between factors and responses

  • Regression analysis to generate predictive equations for optimization

• Appropriate significance testing:

  • Utilize post-hoc tests (Tukey's HSD, Bonferroni, Dunnett's) after ANOVA to identify specific differences between conditions

  • Apply non-parametric alternatives (Kruskal-Wallis, Mann-Whitney U) when data violates normality assumptions

• Robust experimental design considerations:

  • Power analysis to determine adequate sample sizes

  • Blocking techniques to control for batch effects

  • Randomization to minimize systematic errors

• Model validation approaches:

  • Cross-validation to assess predictive accuracy

  • Residual analysis to verify model assumptions

  • Confirmation experiments at predicted optimal conditions

For complex expression optimization, software packages specifically designed for DoE analysis facilitate comprehensive statistical evaluation. These tools can generate contour plots and response surfaces that visualize the relationship between multiple factors and protein yield, helping to identify optimal expression conditions . Such statistical rigor is essential for distinguishing meaningful effects from experimental noise in the multi-parameter space of recombinant protein expression.

How can researchers determine if structural differences in recombinant versus native ndhC affect functional studies?

Determining whether structural differences between recombinant and native ndhC impact functional studies requires systematic comparative analysis:

• Structural comparison techniques:

  • High-resolution comparative spectroscopy (CD, FTIR) to assess secondary structure elements

  • NMR spectroscopy for atomic-level structural comparisons where feasible

  • HDX-MS (Hydrogen-Deuterium Exchange Mass Spectrometry) to compare conformational dynamics

  • Limited proteolysis patterns to detect differences in exposed regions

• Functional equivalence assessment:

  • Side-by-side activity assays under identical conditions

  • Enzyme kinetics analysis (Km, Vmax, substrate specificity)

  • Electron transfer efficiency measurements

  • Binding affinity comparisons with interaction partners

• Environmental sensitivity testing:

  • Stability comparisons across pH, temperature, and ionic strength gradients

  • Detergent/lipid composition effects on structure and function

  • Redox state sensitivity analysis

• Complementation studies:

  • In vivo replacement of native protein with recombinant versions

  • Phenotypic rescue assessment in knockout/mutant systems

  • Quantification of rescue efficiency under various stress conditions

• Post-translational modification analysis:

  • Identification of native modifications using mass spectrometry

  • Generation of modified recombinant protein to match native state

  • Functional assessment of modified versus unmodified recombinant protein

If structural or functional differences are identified, researchers should systematically modify expression and purification protocols to minimize these differences. Where complete equivalence cannot be achieved, studies should explicitly acknowledge limitations and interpret results accordingly.

How can recombinant ndhC contribute to understanding photosynthetic electron transport in stress conditions?

Recombinant ndhC provides a powerful tool for dissecting the role of NDH complexes in photosynthetic stress responses through several research approaches:

• In vitro stress simulation studies:

  • Reconstituting recombinant ndhC into liposomes or nanodiscs with varying lipid compositions that mimic stress conditions

  • Measuring electron transport kinetics under controlled temperature, light intensity, pH, and salt stress conditions

  • Quantifying the impact of reactive oxygen species on ndhC function and stability

• Structure-function analysis under stress:

  • Engineering site-specific mutations in conserved domains to identify residues critical for stress tolerance

  • Comparing wild-type and mutant ndhC activity under normal and stress conditions

  • Correlating structural changes (detected via spectroscopic methods) with functional impacts during stress

• Interaction dynamics during stress adaptation:

  • Using pull-down assays with recombinant ndhC to identify stress-specific interaction partners

  • Quantifying changes in binding affinities between ndhC and other NDH complex subunits under various stress conditions

  • Mapping phosphorylation or other post-translational modification sites that may regulate stress responses

• Comparative studies across species:

  • Producing recombinant ndhC from multiple species with different stress tolerances

  • Analyzing sequence-structure-function relationships that correlate with ecological adaptations

  • Performing domain swapping between species to identify regions conferring enhanced stress resistance

This research has significant implications for understanding photosynthetic adaptation to climate change and could contribute to engineering crops with improved stress tolerance through targeted modifications of the NDH complex.

What are the emerging techniques for studying ndhC protein-protein interactions in the thylakoid membrane?

Emerging techniques for studying ndhC protein-protein interactions in the thylakoid membrane combine advances in membrane protein research with cutting-edge biophysical methods:

• Advanced microscopy approaches:

  • Single-molecule Förster Resonance Energy Transfer (smFRET) to measure dynamic interactions in reconstituted systems

  • Super-resolution microscopy (STORM, PALM) to visualize ndhC distribution and clustering in native and model membranes

  • Correlative light and electron microscopy (CLEM) to connect functional states with structural arrangements

• Native mass spectrometry innovations:

  • Membrane-protein-adapted native MS to determine intact complex composition

  • Crosslinking mass spectrometry (XL-MS) with MS-cleavable crosslinkers to map interaction interfaces

  • Ion mobility-mass spectrometry (IM-MS) to characterize conformational states of complexes

• In situ structural methods:

  • Cryo-electron tomography of thylakoid membranes to visualize NDH complexes in their native environment

  • Subtomogram averaging to achieve higher resolution of specific complexes

  • In-cell NMR with isotopically labeled proteins to detect interactions in living systems

• Computational integration approaches:

  • Molecular dynamics simulations of ndhC in lipid bilayers with other NDH components

  • Coevolutionary analysis to predict interaction interfaces

  • Integration of experimental data into structural models using hybrid methods

• Proximity labeling methods:

  • Enzyme-catalyzed proximity labeling (BioID, APEX) adapted for chloroplast applications

  • Spatially-resolved proteomic mapping of the ndhC interaction network

  • Time-resolved proximity labeling to capture dynamic interaction changes

These techniques are particularly valuable for membrane proteins like ndhC, where traditional interaction studies are complicated by the lipid environment. Combining multiple approaches provides complementary data that can overcome the limitations of individual methods.

What are the recommended best practices for researchers working with recombinant ndhC?

Researchers working with recombinant ndhC should adhere to the following best practices to maximize experimental success and data reliability:

• Expression optimization:

  • Implement DoE approaches rather than one-factor-at-a-time optimization

  • Test multiple expression systems (E. coli strains, cell-free systems, eukaryotic hosts)

  • Optimize growth temperature (preferably 28-30°C), inducer concentration (typically 0.1 mM IPTG), and post-induction time (4-5 hours) for E. coli expression

  • Include fusion partners like SUMO to enhance solubility

• Purification considerations:

  • Maintain detergent throughout all purification steps

  • Screen multiple detergents (DDM, LDAO, digitonin) for optimal protein stability

  • Use multi-step purification strategies combining affinity and size exclusion chromatography

  • Verify protein integrity through analytical SEC and activity assays after each purification step

• Storage and handling:

  • Store purified protein at -80°C in 50% glycerol or flash-frozen in liquid nitrogen

  • Avoid repeated freeze-thaw cycles by preparing single-use aliquots

  • Include reducing agents (DTT, TCEP) to prevent oxidation of cysteine residues

  • Monitor stability at regular intervals through activity assays

• Experimental controls:

  • Include non-functional mutants as negative controls

  • Compare results to native protein preparations where possible

  • Validate activity using multiple complementary assay methods

  • Assess oligomeric state before functional studies

• Data reporting standards:

  • Thoroughly document all experimental conditions

  • Report protein yields, purity (with supporting gel images), and specific activity

  • Include all negative or contradictory results in publications

  • Deposit expression constructs in public repositories

Adhering to these practices enhances reproducibility and facilitates comparison across different studies, ultimately accelerating progress in understanding this complex chloroplastic protein.

How can researchers contribute to the collaborative advancement of ndhC research?

Researchers can foster collaborative advancement in ndhC research through several strategic approaches:

• Resource sharing and standardization:

  • Deposit sequence-verified expression constructs in public repositories (Addgene, DNASU)

  • Establish and share detailed protocols via platforms like protocols.io

  • Develop standard operating procedures for activity assays and purification methods

  • Create and distribute validated antibodies and reference materials

• Data integration and accessibility:

  • Deposit raw mass spectrometry data in resources like PRIDE

  • Share structural data through PDB, EMDB, or BMRB

  • Contribute to functional annotation in UniProt and other databases

  • Utilize open science platforms for sharing preliminary results

• Methodological cross-validation:

  • Participate in multi-laboratory studies to validate key findings

  • Establish benchmark datasets for comparing new methodologies

  • Implement interlaboratory proficiency testing for critical assays

  • Develop reference standards for quantitative measurements

• Interdisciplinary collaboration frameworks:

  • Bridge structural biology, biochemistry, plant physiology, and agricultural science

  • Integrate computational prediction with experimental validation

  • Connect fundamental research to applied studies in crop improvement

  • Develop shared ontologies and data models for consistent annotation

• Knowledge dissemination beyond publications:

  • Create specialized training workshops for new researchers

  • Develop open educational resources for techniques specific to NDH complex research

  • Establish regular focused conference sessions or virtual meetups

  • Implement mentoring programs connecting established and early-career researchers

These collaborative approaches create a more efficient research ecosystem that accelerates discovery while ensuring reproducibility and translation of findings into applications for understanding and potentially improving photosynthetic efficiency.

What future research directions hold the most promise for advancing understanding of ndhC function and applications?

Several high-potential research directions can significantly advance our understanding of ndhC function and applications:

• Structural biology frontiers:

  • High-resolution structure determination of ndhC within the intact NDH complex

  • Time-resolved structural studies to capture conformational changes during electron transport

  • Comparative structural analysis across evolutionary diverse species to identify conserved functional elements

• Systems biology integration:

  • Multi-omics approaches connecting ndhC function to global photosynthetic regulation

  • Metabolic flux analysis to quantify the contribution of NDH-dependent cyclic electron flow to plant productivity

  • Network modeling to predict the system-wide effects of ndhC modifications

• Synthetic biology applications:

  • Engineering optimized ndhC variants with enhanced stability or activity

  • Developing synthetic electron transport chains with modified properties for biotechnological applications

  • Creating minimal synthetic systems to study fundamental electron transport mechanisms

• Climate adaptation research:

  • Investigating natural ndhC variants from plants adapted to extreme environments

  • Assessing the role of ndhC in photoprotection during combined stress conditions

  • Exploring potential for engineering improved crop resilience through NDH complex modifications

• Emerging technological applications:

  • Bio-inspired solar energy conversion systems based on NDH complex principles

  • Biosensor development utilizing ndhC electron transport properties

  • Bioelectronic devices incorporating purified NDH components for energy conversion