Recombinant Oenothera elata subsp. hookeri NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE)

Shipped with Ice Packs
In Stock

Description

Functional Role in Chloroplasts

ndhE contributes to the NDH complex's role in cyclic electron flow around photosystem I (PSI) and chlororespiration:

  • Electron Transport: Shuttles electrons from NAD(P)H to plastoquinone, linked to proton gradient formation .

  • Stress Adaptation: Supports photosynthetic efficiency under fluctuating light conditions by maintaining redox balance .

Expression Systems

  • Yeast: Used for partial constructs (e.g., Product Code CSB-YP881970OAS1), yielding soluble protein with >85% purity .

  • E. coli: Full-length constructs (1–101 aa) fused to N-terminal His tags enable high-yield purification for structural studies .

Plastome-Genome Coevolution

  • Oenothera plastid chromosomes exhibit unique inversions and sequence divergences, including in ndhE-associated regions, which influence interspecific plastome-genome incompatibility .

  • Comparative sequencing of five Oenothera plastomes revealed conserved NDH subunits but lineage-specific adaptations in ndhE homologs, suggesting functional diversification .

Applications in Biotechnology

  • Photosynthesis Research: Used to dissect NDH complex assembly and electron transport mechanisms .

  • Evolutionary Studies: Serves as a marker for analyzing plastid genome stability in Oenothera hybrids .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize development according to your requirements.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Oenothera elata subsp. hookeri (Hooker's evening primrose) (Oenothera hookeri)
Target Names
ndhE
Target Protein Sequence
MILEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNSVNLNFVTFSDFFDSRQLKGD IFSIFIIAIAAAEAAIGLAIVSSIYRNRKSIRINQSNLLNK
Uniprot No.

Target Background

Function
NDH facilitates electron transport from NAD(P)H:plastoquinone, through FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and potentially in a chloroplast respiratory chain. In this species, the immediate electron acceptor for the enzyme is thought to be plastoquinone. This process couples the redox reaction with proton translocation, thereby conserving redox energy as a proton gradient.
Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and function of NAD(P)H-quinone oxidoreductase subunit 4L in Oenothera elata?

NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE) from Oenothera elata subsp. hookeri is a protein component of the NAD(P)H dehydrogenase complex involved in electron transport. The protein consists of 101 amino acids with the sequence: MILEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNSVNLNFVTFSDFFDSRQLKGDIFSIFIIAIAAAEAAIGLAIVSSIYRNRKSIRINQSNLLNK . It functions with EC number 1.6.5.- and is also known as NAD(P)H dehydrogenase subunit 4L or NADH-plastoquinone oxidoreductase subunit 4L . The protein plays a critical role in electron transfer within the chloroplast, contributing to cellular energy metabolism in this evening primrose species.

How does the genetic organization of ndhE in Oenothera elata compare to other Oenothera species?

The ndhE gene in Oenothera elata exhibits distinct organizational patterns when compared to other Oenothera species like O. biennis and O. villaricae. While all three species contain repetitive elements in their mitochondrial genomes, O. elata contains only five repeat pairs compared to seven in O. villaricae and six in O. biennis . These differences reflect evolutionary divergence in the Oenothera genus. The ndhE gene is part of a complex genomic structure involving recombinogenic repeat pairs (RRPs) that have been classified into long-size repeats (LSR), intermediate-size repeats (ISR), and small-size repeats (SSR) . This organization contributes to the dynamic nature of the mitochondrial genome in these species.

What experimental approaches are most effective for studying ndhE expression and activity?

For studying ndhE expression and activity, a multi-faceted approach is recommended. Begin with recombinant protein expression systems using the full amino acid sequence (residues 1-101) . Purification should be performed using Tris-based buffer with 50% glycerol . When designing expression studies, consider the unique stoichiometric patterns observed in O. elata, where certain configurations predominate in recombinogenic repeat pairs . Functional characterization can be performed using enzymatic assays specific to NAD(P)H dehydrogenase activity. For in vivo studies, comparative analysis across Oenothera species can provide valuable insights, particularly focusing on the unique repeat structures present in O. elata compared to O. biennis and O. villaricae .

How can genome assembly techniques be optimized for accurate identification of ndhE and related genomic features in Oenothera species?

Optimizing genome assembly for accurate ndhE identification in Oenothera species requires specialized approaches due to the complex repetitive structure of their mitochondrial genomes. Graph-based models have proven effective, as demonstrated in recent research on three major Oenothera species . Begin with high-quality DNA extraction followed by both short-read (Illumina) and long-read (PacBio) sequencing for comprehensive coverage. Assembly should incorporate specialized algorithms capable of resolving repetitive regions, particularly important given that O. elata contains five recombinogenic repeat pairs of varying sizes . Post-assembly, validation should be conducted using both bioinformatic approaches and wet lab techniques to confirm predicted structures. This dual validation approach is crucial for accurately identifying the ndhE gene within its genomic context of recombination-prone regions.

What methodological considerations are essential when analyzing the stoichiometric relationships of recombinogenic repeat pairs in Oenothera elata mitochondrial genome?

When analyzing stoichiometric relationships of recombinogenic repeat pairs (RRPs) in the O. elata mitochondrial genome, several critical methodological considerations must be addressed. First, employ both Illumina mate-pair (5 kb insert size) and total DNA PacBio RSII (size selection > 5 kb) sequencing to capture comprehensive genomic information . Develop a custom data processing pipeline specifically designed to overcome the peculiarities of these datasets when mapping to contigs in the final IDBA graph of O. elata . For quantitative analysis, calculate read counts for all four possible circular recombination configurations (CRCs) of each RRP to determine their relative abundance.

The analysis of O. elata has revealed that all RRPs, regardless of size, follow a 'group 2' pattern where two out of four configurations are equally abundant while the other two are underrepresented . This pattern is illustrated in the following data from one representative repeat (johSt_3550):

ConfigurationIllumina ReadsIllumina %PacBio ReadsPacBio %
Conf 13461%604%
Conf 215,53849%57939%
Conf 314,86547%73650%
Conf 49663%936%

These stoichiometric patterns provide crucial insights into the recombination dynamics of the mitochondrial genome in O. elata .

What are the most effective protein purification strategies for obtaining high-quality ndhE for structural studies?

Obtaining high-quality Recombinant Oenothera elata subsp. hookeri NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE) for structural studies requires a carefully optimized purification protocol. Begin with expression of the full-length protein (amino acids 1-101) in a suitable expression system . After cell lysis, perform initial purification using affinity chromatography based on the tag determined during the production process . Follow with size exclusion chromatography to ensure sample homogeneity. Throughout purification, maintain the protein in Tris-based buffer with 50% glycerol as recommended by established protocols .

For storage, aliquot the purified protein and store at -20°C for extended periods, avoiding repeated freeze-thaw cycles which can compromise structural integrity . For working stocks, store aliquots at 4°C for up to one week . Prior to structural studies such as X-ray crystallography or cryo-electron microscopy, perform quality control assessments including SDS-PAGE, dynamic light scattering, and circular dichroism to verify protein purity, homogeneity, and proper folding. These steps are essential to ensure that the structural data obtained accurately represents the native conformation of ndhE.

How do the repeat structures in Oenothera elata mitochondrial genome compare with those in other Oenothera species, and what are the implications for ndhE evolution?

The repeat structures in the mitochondrial genome of Oenothera elata show distinctive patterns compared to other Oenothera species, with significant implications for ndhE evolution. Comparative analysis reveals that O. elata contains five recombinogenic repeat pairs (RRPs), while O. villaricae harbors seven and O. biennis contains six . These RRPs are categorized as large, intermediate, and small-size repeats based on k-means clustering analysis of genome-wide repeat data .

The following table summarizes the distribution of repeat types across the three species:

Repeat TypeO. villaricaeO. biennisO. elataAssociated Gene
LSRberS_121 (1337 bp)suavG_4381 (1316 bp)johSt_1348 (1352 bp)atp9
LSR-suavG_152 (1625 bp)--
LSR/ISRberS_443 (475 bp)suavG_1116 (479 bp)johSt_3550 (825 bp)nad6
ISRberS_539 (421 bp)suavG_1464 (397 bp)johSt_12875 (397 bp)-
ISR-suavG_1599 (370 bp)johSt_14298 (370 bp)-
ISR-suavG_4379 (260 bp)johSt_20236 (261 bp)atp1
SSR--johSt_20316 (171 bp)nad5

Each Oenothera species possesses a unique long-size repeat, while three intermediate-size repeats are shared among all species . This pattern suggests both conservation and divergence in the evolution of repeat structures. For ndhE evolution, these differences indicate distinct selective pressures and evolutionary trajectories across Oenothera species, potentially affecting the functional properties of the protein. The association of certain repeats with specific genes (e.g., nad6, atp1, nad5) further suggests coordinated evolution of mitochondrial components including ndhE .

What statistical approaches are most appropriate for analyzing the stoichiometric relationships in mitochondrial genome configurations?

For analyzing stoichiometric relationships in mitochondrial genome configurations, particularly in Oenothera species, multiple statistical approaches should be employed. First, quantitative analysis of read coverage from both short-read (Illumina) and long-read (PacBio) sequencing data is essential for accurate estimation of relative abundance . When analyzing the four possible circular recombination configurations (CRCs) for each recombinogenic repeat pair, calculate percentage distributions to identify predominant configurations .

Statistical comparison between different sequencing technologies is crucial for validation. In the case of O. elata, both Illumina and PacBio sequencing showed similar distribution patterns for CRCs, strengthening confidence in the results . For example, for repeat johSt_3550, configurations 2 and 3 showed similar abundance (49% and 47% in Illumina; 39% and 50% in PacBio), while configurations 1 and 4 were significantly underrepresented .

To account for sequencing biases, calculate usage factors that normalize read counts based on genomic context. In O. elata analysis, usage factors ranged from 1.5 to 2.8 for Illumina data and 1.7 to 2.8 for PacBio data across different repeats . Apply clustering analysis (such as k-means) to categorize repeats into distinct groups based on their recombination patterns . Finally, use comparative statistical analysis across species to identify evolutionary patterns and conserved stoichiometric relationships.

How can researchers integrate protein structure-function relationships of ndhE with genomic data to understand its role in Oenothera metabolism?

Integrating protein structure-function relationships of ndhE with genomic data requires a multi-omics approach. Begin by analyzing the complete amino acid sequence of Oenothera elata subsp. hookeri NAD(P)H-quinone oxidoreductase subunit 4L (MILEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNSVNLNFVTFSDFFDSRQLKGDIFSIFIIAIAAAEAAIGLAIVSSIYRNRKSIRINQSNLLNK) using structural prediction tools to identify functional domains. The presence of transmembrane regions, suggested by the hydrophobic amino acid clusters, indicates membrane association within the chloroplast .

Cross-reference these structural features with genomic context data, particularly focusing on the repetitive elements and their stoichiometric relationships in the mitochondrial genome . The association of certain repeats with specific genes (such as nad6, atp1, and nad5) suggests potential co-regulation or functional relationships between these components . Experimental validation should include site-directed mutagenesis of key residues identified through structural analysis, followed by functional assays to measure NAD(P)H dehydrogenase activity.

For comprehensive metabolic integration, employ metabolomic approaches to identify changes in metabolite profiles when ndhE function is altered. Compare these findings across different Oenothera species to identify conserved metabolic roles versus species-specific adaptations. This integrated approach provides a holistic understanding of how ndhE structure relates to its function within Oenothera metabolism, bridging the gap between genomic organization and biochemical activity.

What are the common challenges in expressing and purifying recombinant ndhE, and how can researchers overcome them?

Expressing and purifying recombinant Oenothera elata subsp. hookeri NAD(P)H-quinone oxidoreductase subunit 4L presents several challenges. First, the hydrophobic nature of this membrane-associated protein (evident from its amino acid sequence) often leads to aggregation during expression . To overcome this, researchers should optimize expression systems by using specialized strains designed for membrane proteins, lower expression temperatures (16-20°C), and membrane-mimetic environments during purification.

Second, proper folding of ndhE can be problematic. Incorporate chaperone co-expression strategies and validate protein folding using circular dichroism or limited proteolysis. Third, maintaining protein stability during purification is critical. The recommended storage in Tris-based buffer with 50% glycerol helps maintain stability , but additional stabilizing agents such as specific lipids or mild detergents may be necessary during purification steps.

Fourth, achieving high purity for structural studies requires multiple purification steps. Follow initial affinity chromatography with size exclusion and ion exchange chromatography. Finally, preventing proteolytic degradation is essential. Add protease inhibitors during all purification steps and minimize sample handling time. For working with ndhE specifically, store at -20°C for long-term storage and avoid repeated freeze-thaw cycles by maintaining working aliquots at 4°C for up to one week .

How can researchers address the technical challenges in analyzing complex repetitive structures in Oenothera mitochondrial genomes?

Analyzing complex repetitive structures in Oenothera mitochondrial genomes presents significant technical challenges that require specialized approaches. First, sequencing strategy is critical—combine short-read (Illumina) and long-read (PacBio) technologies to capture both high accuracy and long-range structural information . For O. elata specifically, mate-pair libraries with 5 kb insert size and PacBio reads with size selection >5 kb have proven effective .

Second, assembly algorithms must be carefully selected. Graph-based assembly approaches are particularly valuable for resolving repetitive regions, as demonstrated in recent Oenothera research . Custom data processing pipelines may be necessary to overcome dataset-specific peculiarities when mapping reads to assembled contigs .

Third, validation is essential. Employ both bioinformatic and experimental approaches to confirm predicted structures. For example, recombinogenic repeat pairs should be validated using PCR across predicted junctions and sequencing of the amplicons. Fourth, quantitative analysis of repeat configurations requires sophisticated read counting approaches that can distinguish between similar sequences. Develop custom scripts that account for the unique challenges of each dataset .

Finally, comparative analysis across species provides valuable context. The identification of shared repeats among Oenothera species (like the three intermediate-size repeats common to O. elata, O. biennis, and O. villaricae) helps validate findings and place them in evolutionary context .

What strategies can be employed to resolve contradictory data when studying ndhE function across different experimental systems?

When facing contradictory data regarding ndhE function across different experimental systems, researchers should implement a systematic troubleshooting approach. First, establish a standardized experimental framework that controls for variables such as protein concentration, buffer composition, and assay conditions. The recommended storage in Tris-based buffer with 50% glycerol provides a starting point for standardization .

Second, perform comprehensive validation across multiple methodologies. If protein activity assays yield contradictory results, validate using orthogonal techniques such as spectroscopic methods, isothermal titration calorimetry, and in vivo functional complementation. Third, consider species-specific variations. The genomic analysis of Oenothera species reveals significant differences in repetitive element organization , which may translate to functional differences in ndhE across species.

Fourth, examine post-translational modifications. The amino acid sequence of ndhE (MILEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNSVNLNFVTFSDFFDSRQLKGDIFSIFIIAIAAAEAAIGLAIVSSIYRNRKSIRINQSNLLNK) contains potential modification sites that could affect function . Use mass spectrometry to identify and characterize these modifications. Fifth, analyze protein-protein interactions, as ndhE functions as part of a larger complex.

Finally, employ meta-analysis techniques to integrate contradictory data sets, identifying patterns that may explain discrepancies. When publishing, transparently report all experimental conditions and contradictions to advance collective understanding of this complex protein.

How might the study of ndhE contribute to our understanding of plant adaptation to environmental stress?

The study of NAD(P)H-quinone oxidoreductase subunit 4L (ndhE) from Oenothera elata has significant potential to enhance our understanding of plant adaptation to environmental stress. This protein, as a component of the NAD(P)H dehydrogenase complex , plays a crucial role in electron transport within chloroplasts, which is directly linked to photosynthetic efficiency under varying environmental conditions. Research should focus on comparing ndhE function across Oenothera species adapted to different habitats, leveraging the known genomic differences among O. elata, O. biennis, and O. villaricae .

The unique repeat structure in the O. elata mitochondrial genome, with only five recombinogenic repeat pairs compared to six in O. biennis and seven in O. villaricae , may reflect adaptive changes in energy metabolism. Functional studies should investigate how these genomic differences translate to altered ndhE activity under various stress conditions such as drought, high light intensity, and temperature fluctuations. The association of certain repeats with genes like atp9, atp1, and nad5 suggests coordinated evolution of the energy production apparatus, potentially as an adaptive response.

Comparative transcriptomic and proteomic analyses across stress conditions would reveal how ndhE expression and post-translational modifications respond to environmental challenges. This integrated approach would provide valuable insights into the mechanistic basis of Oenothera adaptation to diverse ecological niches.

What emerging technologies show promise for advancing our understanding of the complex genomic organization in Oenothera species?

Several emerging technologies show exceptional promise for advancing our understanding of the complex genomic organization in Oenothera species. Long-read sequencing technologies beyond current PacBio methods, such as Oxford Nanopore Technologies, offer the potential for even longer reads that can span entire repetitive regions, providing more complete resolution of the complex recombinogenic repeat pairs observed in Oenothera mitochondrial genomes .

Optical mapping technologies, which visualize the physical arrangement of DNA molecules, could complement sequencing approaches by providing independent validation of genomic structures. This would be particularly valuable for verifying the arrangement of the various repeat types (LSR, ISR, and SSR) identified in Oenothera species .

Chromatin conformation capture techniques (Hi-C and its derivatives) could reveal the three-dimensional organization of the mitochondrial genome, potentially uncovering how structural arrangement affects the function of genes like ndhE. CRISPR-Cas9 genome editing in Oenothera would enable precise manipulation of repetitive elements to study their functional significance.

Single-cell genomics and transcriptomics could reveal cell-to-cell variation in mitochondrial genome configurations, providing insights into the dynamic nature of the stoichiometric relationships observed in recombinogenic repeat pairs . Integration of these technologies with advanced computational approaches will be essential for fully unraveling the complex genomic architecture of Oenothera species.

How can the study of ndhE in Oenothera species inform broader questions about the evolution of plant energy metabolism?

The study of ndhE in Oenothera species offers a unique window into the evolution of plant energy metabolism. The distinct patterns of recombinogenic repeat pairs observed across O. elata, O. biennis, and O. villaricae provide a natural experiment in genomic organization and its impact on energy metabolism. By comparing ndhE structure, function, and regulation across these related species, researchers can track evolutionary trajectories and selective pressures on plant energy systems.

The association of certain repeats with specific genes involved in energy metabolism (atp9, atp6, nad6, atp1, nad5) suggests co-evolution of these components. This genomic linkage may reflect functional interactions that have been preserved through evolutionary time. Comparative biochemical studies of ndhE activity across Oenothera species could reveal how subtle amino acid changes affect enzyme kinetics and substrate specificity, providing insights into the molecular evolution of energy metabolism.

The stoichiometric relationships observed in mitochondrial genome configurations may have profound implications for the balance of energy production pathways. Research should investigate whether these stoichiometric patterns correlate with metabolic flux distributions across different growth conditions and species. Additionally, horizontal gene transfer analysis could reveal instances where ndhE or related components were acquired from other organisms, potentially leading to metabolic innovations.

By placing Oenothera ndhE in a broader phylogenetic context, researchers can reconstruct the evolutionary history of plant energy metabolism systems, identifying conserved core functions and lineage-specific adaptations that have shaped plant energy metabolism throughout evolutionary history.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.