Recombinant Oenothera elata subsp. hookeri NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG)

Shipped with Ice Packs
In Stock

Description

Functional Role in Chloroplast Metabolism

The ndhG subunit is integral to the NDH complex, which mediates:

  • Cyclic Electron Transport: Recirculates electrons to enhance ATP synthesis under stress .

  • Chlororespiration: Maintains redox balance by oxidizing NAD(P)H in the chloroplast stroma .

  • ROS Scavenging: Mitigates reactive oxygen species (ROS) during high-light stress .

In Oenothera, the NDH complex is encoded by a conserved chloroplast operon (ndhA–ndhK), with ndhG located downstream of ndhI . Structural analyses reveal that ndhG anchors the NDH complex to the thylakoid membrane, facilitating interactions with other subunits like ndhH and ndhI .

Plastome-Genome Incompatibility (PGI)

A 194 bp deletion in the ndhG–ndhI intergenic spacer region of plastome I is linked to hybrid incompatibility in Oenothera . This deletion disrupts promoter elements critical for operon regulation, leading to:

  • Light-Dependent Transcriptional Dysregulation: Reduced psbB operon expression under high light .

  • Impaired Photosystem Biogenesis: Downregulation of pbf1 (a PSI/PSII assembly factor) in incompatible hybrids .

Sequence Conservation and Divergence

Comparative plastome analyses of 18 Oenothera strains highlight:

  • High Ka/Ks Ratios: Indicative of positive selection in ndhG and other NDH subunits .

  • Structural Polymorphisms: A 56 kbp inversion in the chloroplast genome affects ndh gene arrangement but preserves functionality .

Experimental Uses

  • Antibody Production: His-tagged ndhG serves as an antigen for polyclonal antibody generation .

  • Enzyme Kinetics: Used to study NAD(P)H oxidation rates under varying redox conditions .

  • Hybrid Compatibility Studies: Tools for dissecting PGI mechanisms in Oenothera hybrids .

Future Directions

  • Structural Biology: Cryo-EM studies to resolve ndhG’s role in NDH complex assembly.

  • Biotechnological Engineering: Modifying ndhG to enhance stress tolerance in crops .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ndhG; NAD(PH-quinone oxidoreductase subunit 6, chloroplastic; NAD(PH dehydrogenase subunit 6; NADH-plastoquinone oxidoreductase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Oenothera elata subsp. hookeri (Hooker's evening primrose) (Oenothera hookeri)
Target Names
ndhG
Target Protein Sequence
MDLPGPIHDFLLVFLGSGLIVGGLGVVLLTNPIFSAFSLGLVLVCISLFFSLSNSYFVAA AQLLIYVGAINVLILFAVMFMNGSEYSKDLTLWTVGDGITSLVCTSIFISLITTILDTSW YGIIWTTKSNQIIEQDLIGNSQQIGIHLSTDFFLPFELISIILLVSLIGAIAVARQ
Uniprot No.

Target Background

Function
NDH transfers electrons from NAD(P)H:plastoquinone, through FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and potentially in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is thought to be plastoquinone. This enzyme couples the redox reaction to proton translocation, thereby conserving the redox energy in a proton gradient.
Protein Families
Complex I subunit 6 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is ndhG and what is its role in photosynthesis?

NAD(P)H-quinone oxidoreductase subunit 6 (ndhG) is a critical component of the NAD(P)H dehydrogenase-like (NDH) complex located in the chloroplasts of Oenothera elata subsp. hookeri. Within this complex, ndhG functions as one of the proton pumps that facilitates electron transport during photosynthesis . The NDH complex redirects electrons from ferredoxin to the plastoquinone pool while simultaneously pumping protons from the stroma into the lumen, creating a proton gradient used for ATP synthesis . This process forms a cyclic electron transport path around Photosystem I (PSI), which becomes particularly important under stress conditions when linear electron flow may be limited .

What genetic variations in ndhG have been identified and what are their functional implications?

Several genetic variations in ndhG have been identified across Oenothera species, with the most significant being the Ile7 to Lys7 substitution . This specific amino acid change has been causally linked to increased recovery of ΦPSII (quantum yield of Photosystem II), suggesting it enhances the efficiency of cyclic electron transport . The table below summarizes key known variations:

VariationPositionFunctional ImpactReference
Ile→Lys7Increased recovery of ΦPSII
Various SNPsMultiple positionsPotential involvement in plastome-genome incompatibility

These variations are particularly interesting in the context of Oenothera's complex evolutionary history, as genes like ndhG with high Ka/Ks ratios (ratio of nonsynonymous to synonymous substitutions) may play active roles in speciation processes .

What are the recommended approaches for studying ndhG function given that it is chloroplast-encoded?

Studying chloroplast-encoded genes like ndhG presents unique challenges since most transformation or gene editing methods cannot be directly applied . Researchers have developed several effective approaches:

  • Cybrid Analysis: Creating cybrids (cytoplasmic hybrids) that differ specifically in their ndhG alleles allows for controlled comparison of different variants in consistent nuclear backgrounds .

  • Genetic Exclusion Approach: This involves using a full diallel consisting of reciprocal hybrids that differ only for their plasmotype (plastid genome), which allows determination of whether a given plasmotype confers specific phenotypes .

  • Natural Variation Screening: Screening large collections of accessions (e.g., 1,531 accessions with publicly available sequencing information) to identify natural variants that differ in ndhG sequence .

  • High-throughput Phenotyping: Using chlorophyll fluorescence imaging protocols to measure NDH activity via the post-illumination fluorescence rise, allowing for efficient screening of many samples .

These approaches have successfully identified causal relationships between ndhG variants and photosynthetic phenotypes, such as the Ile7 to Lys7 substitution's effect on ΦPSII recovery .

How can researchers measure NDH complex activity to assess ndhG function?

Several complementary methods can be employed to measure ndhG activity as part of the NDH complex:

The combination of these methods has allowed researchers to conclusively demonstrate that specific amino acid substitutions in ndhG, such as the Ile7 to Lys7 change, directly impact NDH activity and photosynthetic performance .

What expression systems and purification protocols are recommended for recombinant ndhG?

Working with recombinant ndhG presents challenges due to its hydrophobic nature and multiple transmembrane domains. Based on information from available resources about membrane proteins with similar characteristics, the following protocol is recommended:

  • Expression Systems:

    • E. coli strains specifically designed for membrane protein expression

    • Inclusion of solubility-enhancing fusion tags (His6, MBP) to improve yield

    • Lower induction temperatures (16-20°C) to reduce inclusion body formation

  • Purification Strategy:

    • Gentle detergent solubilization (DDM, LDAO) of membrane fractions

    • Immobilized metal affinity chromatography (IMAC) for initial purification

    • Size exclusion chromatography for final purification

  • Quality Control:

    • SDS-PAGE and Western blotting to confirm protein identity and purity

    • Verification of secondary structure integrity

    • Functional assays to confirm activity

The commercially available recombinant ndhG protein is supplied in a Tris-based buffer with 50% glycerol, optimized for protein stability , suggesting this buffer composition is suitable for maintaining ndhG in a functional state.

How does ndhG contribute to cyclic electron transport around Photosystem I?

The NDH complex, of which ndhG is an integral component, plays a crucial role in cyclic electron transport (CET) around Photosystem I. This process involves:

  • Electron Acceptance: The NDH complex accepts electrons from ferredoxin, with NdhS serving as a "foothold" for ferredoxin binding through its C-terminal region .

  • Proton Pumping: As electrons flow through the complex, protons are pumped from the stroma into the thylakoid lumen, with ndhG serving as one of the proton pumps .

  • Plastoquinone Reduction: The electrons are transferred to plastoquinone, reducing it to plastoquinol .

  • Electron Return to PSI: Electrons from plastoquinol can then be transferred via the cytochrome b6f complex, plastocyanin, and the reaction center of PSI back to ferredoxin, completing the cycle .

This cyclic flow generates additional ATP without producing NADPH, allowing plants to adjust the ATP:NADPH ratio according to metabolic demands. ndhG's specific role as a proton pump is critical for establishing the proton gradient that drives ATP synthesis .

What environmental conditions increase the importance of ndhG function?

The importance of ndhG function, as part of the NDH complex, increases under several environmental conditions:

  • Fluctuating Light: NDH-mediated cyclic electron flow helps plants adapt to changing light conditions by maintaining photosynthetic efficiency during transitions . The recovery of ΦPSII after photoinhibition is influenced by ndhG variants, with the Ile7 to Lys7 substitution improving recovery .

  • Drought Stress: When water availability is limited, stomatal closure restricts CO2 uptake, creating an imbalance between the light and dark reactions of photosynthesis. Under these conditions, cyclic electron flow becomes more important to dissipate excess energy and maintain ATP production .

  • High Light Stress: Excessive light can lead to photoinhibition and damage to photosynthetic apparatus. NDH-mediated cyclic electron flow helps protect against such damage by alleviating over-reduction of the electron transport chain .

  • Low Temperature: Cold conditions slow down enzymatic reactions of the Calvin cycle more than light reactions, creating an energy imbalance. The NDH complex helps adjust electron flow under these conditions .

The ability of plants to optimize NDH activity through variations in subunits like ndhG may represent an important adaptation to different environmental niches .

How does ndhG function relate to plastome-genome incompatibility in Oenothera?

The phenomenon of plastome-genome incompatibility (PGI) in Oenothera species represents a fascinating example of co-evolution between nuclear and chloroplast genomes, with ndhG playing a significant role:

  • Genetic Background: In Oenothera, five genetically distinguishable plastid chromosomes (I-V) exist that associate with six distinct nuclear genotypes derived from three basic genomes (A, B, C) . Certain plastome-genome combinations that do not occur naturally display interspecific incompatibility .

  • Molecular Evidence: ndhG shows a remarkably high Ka/Ks ratio, indicating it is under positive selection . This signature is consistent with genes involved in speciation processes.

  • Functional Effects: The Ile7 to Lys7 substitution in ndhG affects recovery of ΦPSII , demonstrating how single amino acid changes can impact photosynthetic function. These effects may contribute to reproductive isolation between populations with different plastome-genome combinations.

  • Experimental Verification: Using reciprocal hybrids and cybrids with different nuclear and plastid combinations, researchers have shown that specific ndhG alleles are associated with differences in NDH activity and photosynthetic performance .

This research highlights how ndhG variations may contribute to speciation processes through incompatibility effects when different nuclear and plastid genomes are combined .

How might structural analysis of ndhG inform our understanding of proton pumping mechanisms?

Advanced structural analysis of ndhG could provide crucial insights into proton pumping mechanisms in the NDH complex:

  • Transmembrane Channel Identification: Detailed structural information could reveal the specific amino acid residues that form the proton translocation pathway through the membrane.

  • Conformational Changes: Understanding how ndhG changes conformation during the catalytic cycle would illuminate the mechanical aspects of proton pumping.

  • Interaction Interfaces: Mapping the interactions between ndhG and other NDH subunits would show how the complex coordinates electron transfer with proton pumping.

  • Variant Impact Prediction: Structural insights would allow researchers to predict how variations like the Ile7 to Lys7 substitution affect protein function at the molecular level .

  • Comparative Analysis: Structural comparison between different species' ndhG proteins could explain adaptive differences in NDH activity across diverse environmental conditions.

Current structural biology techniques, including cryo-electron microscopy and integrated approaches combining multiple methods, are increasingly capable of resolving membrane protein structures at resolutions that provide this level of mechanistic detail.

What potential applications exist for enhancing crop photosynthetic efficiency through ndhG engineering?

Understanding ndhG function opens several avenues for enhancing photosynthetic efficiency in crops:

The correlation between ndhG variants and photosynthetic recovery after stress suggests that this approach could be particularly valuable for improving crop resilience in variable environments.

How does ndhG interact with ferredoxin to facilitate electron transport and what are the implications for photosynthetic efficiency?

The interaction between the NDH complex (including ndhG) and ferredoxin is crucial for cyclic electron transport:

  • Binding Mechanism: While ndhG itself is not directly involved in ferredoxin binding, it works in concert with other NDH subunits. NdhS serves as a "foothold" for ferredoxin binding through its C-terminal region, which contains positively charged lysine residues that interact with the negatively charged patch of ferredoxin .

  • Electron Transfer Pathway: Once ferredoxin is bound, electrons are transferred to the NDH complex and subsequently used to reduce plastoquinone. ndhG participates in coupling this electron transfer to proton pumping across the thylakoid membrane .

  • Regulatory Implications: The interaction between ferredoxin and the NDH complex may be regulated by factors such as the redox state of the chloroplast and the demand for ATP relative to NADPH.

  • Efficiency Considerations: The efficiency of this interaction directly impacts the rate of cyclic electron flow and, consequently, the plant's ability to optimize photosynthetic performance under varying conditions .

  • Evolutionary Adaptations: Variations in ndhG and other NDH components may reflect adaptations to different environmental niches, where specific properties of the ferredoxin-NDH interaction provide selective advantages .

Understanding this interaction at the molecular level could inform strategies to enhance cyclic electron flow in crops, potentially improving their photosynthetic efficiency and stress resilience.

What emerging technologies could advance our understanding of ndhG structure and function?

Several cutting-edge technologies offer promising avenues for advancing ndhG research:

  • Cryo-Electron Microscopy: High-resolution structures of the entire NDH complex would reveal ndhG's precise position and functional interactions with other subunits.

  • Single-Molecule Techniques: Methods such as single-molecule FRET could track conformational changes in ndhG during the catalytic cycle, providing insights into the mechanics of proton pumping.

  • Advanced Spectroscopy: Time-resolved spectroscopic techniques could capture the dynamics of electron transfer and proton translocation in real-time.

  • Molecular Dynamics Simulations: Computational approaches could model how mutations in ndhG affect protein structure and function, helping predict the impact of natural or engineered variations.

  • High-Throughput Phenotyping: Advanced chlorophyll fluorescence imaging platforms could screen large populations for variation in NDH activity, facilitating the discovery of novel ndhG variants with enhanced function .

  • Chloroplast Genome Editing: Emerging techniques for precise editing of the chloroplast genome could enable direct testing of ndhG variants in planta, overcoming current limitations in chloroplast transformation.

These technologies, particularly when used in combination, have the potential to significantly advance our understanding of how ndhG contributes to photosynthetic efficiency and plant adaptation to environmental stress.

What important knowledge gaps remain in our understanding of ndhG function?

Despite significant progress, several important knowledge gaps remain in our understanding of ndhG:

  • Proton Pathway Mechanics: The exact pathway and mechanism by which ndhG contributes to proton translocation across the membrane remain incompletely characterized.

  • Regulatory Mechanisms: How ndhG function is regulated in response to changing environmental conditions and metabolic demands is not fully understood.

  • Interaction Dynamics: The dynamic interactions between ndhG and other components of the NDH complex during the catalytic cycle require further elucidation.

  • Evolutionary History: While ndhG shows signatures of positive selection , the specific selective pressures that have shaped its evolution across different plant lineages remain to be fully characterized.

  • Phenotypic Impact Range: The full range of photosynthetic and physiological traits affected by ndhG variations has not been comprehensively mapped.

  • Structure-Function Relationships: The precise structural basis for how variations like the Ile7 to Lys7 substitution affect function remains to be determined at the molecular level .

Addressing these knowledge gaps will require integrated approaches combining structural biology, biochemistry, genetics, and physiological studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.