Recombinant Oenothera elata subsp. hookeri Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ycf4; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-184
Protein Length
full length protein
Species
Oenothera elata subsp. hookeri (Hooker's evening primrose) (Oenothera hookeri)
Target Names
ycf4
Target Protein Sequence
MIWRSEHIWIELIVGSRKISNFCWAFLLFLGSLGFVLVGTSSYLGKNLISLVSSQQIHFF PQGLVMSFYGIAGLFISSYLWCTISWNVGSGYDRFDRKEGIVCIFRWGFPGKNRRIFLRF RMKDIQSIRIEVKEGIYARRVLYMEIKGQGAIPLTRSDDNLTLREIEQKAAELAYFLRVP IEVF
Uniprot No.

Target Background

Function

Appears essential for the assembly of the photosystem I complex.

Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How is the ycf4 gene organized in the Oenothera plastid genome?

In Oenothera elata subsp. hookeri, the ycf4 gene is located within a polycistronic transcriptional unit on the chloroplast genome, specifically in the rps9-ycf4-ycf3-rps18 cluster . The complete nucleotide sequence of the Oenothera elata subsp. hookeri strain johansen plastome (designated as plastome I) has been determined and is available in GenBank under accession number AJ271079.3 . Within this genomic organization, ycf4 is co-transcribed with neighboring genes, which is a common feature of chloroplast gene expression. This organization contributes to the coordinated expression of genes involved in related photosynthetic functions.

What are the most effective methods for expressing and purifying recombinant Ycf4 from Oenothera elata subsp. hookeri?

For successful expression and purification of recombinant Oenothera elata subsp. hookeri Ycf4, researchers should consider the following methodological approach:

  • Genetic Construct Design:

    • Clone the ycf4 gene from Oenothera elata subsp. hookeri plastid DNA.

    • Design primers based on the known sequence (GenBank accession: Q9MTL1) .

    • Incorporate appropriate affinity tags (His-tag or TAP-tag) for purification.

  • Expression System Selection:

    • For membrane proteins like Ycf4, E. coli-based expression systems with specialized strains (C41/C43) designed for membrane protein expression are recommended.

    • Alternatively, use chloroplast transformation in model organisms like C. reinhardtii or tobacco.

  • Purification Strategy:

    • Implement a TAP-tag (Tandem Affinity Purification) strategy as demonstrated in studies with Chlamydomonas Ycf4 .

    • Solubilize thylakoid membranes using n-dodecyl-β-d-maltoside (DDM) at 1% concentration.

    • Perform two-step affinity purification using IgG agarose followed by calmodulin resin.

    • For intact complex purification, consider additional steps including sucrose gradient ultracentrifugation and ion exchange chromatography.

  • Quality Control:

    • Verify purification by SDS-PAGE and immunoblotting using anti-Ycf4 antibodies.

    • Assess protein functionality through binding assays with PSI components.

This methodology has been successfully applied to study Ycf4 complexes in Chlamydomonas, where researchers achieved purification of a stable Ycf4-containing complex of >1500 kD .

How can researchers effectively design experiments to study Ycf4 interactions with PSI assembly components?

Designing experiments to study Ycf4 interactions with PSI assembly components requires a multi-faceted approach:

  • Co-immunoprecipitation (Co-IP) Assays:

    • Generate antibodies against Oenothera elata subsp. hookeri Ycf4 or use TAP-tagged Ycf4.

    • Solubilize thylakoid membranes with mild detergents (DDM at 0.5-1%).

    • Precipitate Ycf4 and analyze co-precipitated proteins by immunoblotting or mass spectrometry.

    • This approach successfully identified PSI subunits (PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF) as interaction partners in Chlamydomonas .

  • Pulse-Chase Protein Labeling:

    • Label newly synthesized proteins with radioactive amino acids.

    • Track the association of labeled PSI polypeptides with the Ycf4 complex over time.

    • This method revealed that PSI polypeptides associated with the Ycf4-containing complex are newly synthesized and partially assembled as a pigment-containing subcomplex .

  • Yeast Two-Hybrid or Split-Ubiquitin Assays:

    • For identifying specific binary interactions between Ycf4 and individual PSI components.

    • Modify hydrophobic domains to ensure proper expression in yeast systems.

  • Sucrose Gradient Ultracentrifugation:

    • Separate protein complexes based on size.

    • Analyze fractions by immunoblotting to determine co-migration of Ycf4 with other proteins.

    • This technique showed that Ycf4 and COP2 co-purify, indicating intimate association .

  • Electron Microscopy and Single Particle Analysis:

    • Visualize purified Ycf4 complexes to determine structural features.

    • Previous studies revealed that purified preparations contain structures measuring 285 × 185 Å .

When designing these experiments, researchers should consider the sensitivity of membrane protein complexes to detergent concentrations and salt conditions, as demonstrated by the increased salt sensitivity of Ycf4 complex stability when COP2 levels were reduced .

How does Ycf4 function differ between Oenothera elata subsp. hookeri and other photosynthetic organisms?

The function of Ycf4 shows important evolutionary variations across photosynthetic organisms:

OrganismYcf4 EssentialityPSI Assembly ImpactComplex FormationResearch Methods Used
Oenothera elata subsp. hookeriEssential (inferred)Critical for PSI assemblyForms large complexesGenetic analysis, plastome sequencing
Chlamydomonas reinhardtiiEssentialComplete loss of PSI in mutantsForms >1500 kD complex with COP2 and PSI subunitsTAP-tagging, mass spectrometry, electron microscopy
Arabidopsis thaliana (Pyg)EssentialCritical for PSI assemblyComplex formation confirmedGenetic knockouts, spectroscopic analysis
CyanobacteriaNon-essentialReduced PSI levels in mutantsLess stable complexMutant analysis, spectroscopy

This comparative analysis reveals an evolutionary trend in which Ycf4 function has become more critical in eukaryotic photosynthetic organisms compared to prokaryotic cyanobacteria. In Oenothera elata subsp. hookeri, based on genetic studies and its high conservation in the plastome, Ycf4 is likely essential for PSI assembly as in other higher plants. The protein forms part of a large complex similar to that observed in Chlamydomonas, though specific interacting partners may vary .

Research methods to investigate these differences include:

  • Cross-species complementation experiments

  • Domain-swapping between Ycf4 proteins from different species

  • Comparative structural analysis of Ycf4 complexes

  • Phylogenetic analysis of functional domains

These approaches can help determine which specific structural features of Ycf4 contribute to its essential nature in eukaryotes versus its regulatory role in cyanobacteria .

What is the role of Ycf4 in plastome-genome incompatibility (PGI) in Oenothera species?

Oenothera species represent a unique model for studying speciation mechanisms, particularly plastome-genome incompatibility (PGI) . While direct evidence linking Ycf4 to PGI is limited, several lines of investigation suggest potential involvement:

  • Plastome Divergence Analysis:

    • Five genetically distinct plastomes (I-V) have been identified in Oenothera species .

    • Plastome I from Oenothera elata subsp. hookeri contains specific variants of photosynthetic genes, including ycf4.

    • Comparative analysis shows variable rates of synonymous (Ks) and non-synonymous (Ka) substitutions in different genes, potentially including ycf4 .

  • Hybrid Incompatibility Observations:

    • Crosses between Oenothera species with different plastomes often result in hybrid offspring displaying chloroplast-nuclear genome incompatibilities .

    • For example, crosses between Oe. elata subsp. hookeri strain johansen (AA-I) and Oe. grandiflora strain tuscaloosa (BB-III) result in a lutescent phenotype with somatic plastome segregation .

    • As a key component of photosynthetic machinery assembly, Ycf4 variants could potentially contribute to these incompatibilities.

  • Experimental Approaches to Test Ycf4's Role in PGI:

    • Generate recombinant plastomes with swapped ycf4 alleles between compatible and incompatible combinations.

    • Measure photosystem II yields in plants with different nuclear-plastome combinations .

    • Analyze co-evolution patterns between nuclear-encoded PSI assembly factors and plastid-encoded Ycf4.

The hypothesis that Ycf4 may contribute to PGI is supported by observations that photosynthetic proteins often show accelerated evolution at speciation boundaries and that hybrid incompatibility in Oenothera primarily manifests through chloroplast-nuclear genome interactions . This area represents a promising frontier for understanding both the functional evolution of Ycf4 and its potential role in reproductive isolation mechanisms.

How should researchers interpret contradictory results regarding Ycf4 essentiality across different photosynthetic organisms?

The varying essentiality of Ycf4 across photosynthetic organisms presents an intriguing evolutionary puzzle that requires careful data interpretation:

When examining seemingly contradictory results, researchers should consider that "essentiality" exists on a spectrum related to assembly efficiency, environmental fitness, and experimental conditions. This perspective helps reconcile observations across species and suggests that Ycf4 function has been fine-tuned throughout evolution to meet the specific needs of different photosynthetic organisms .

What are the key considerations when analyzing evolutionary changes in Ycf4 sequences across Oenothera species?

When analyzing evolutionary changes in Ycf4 sequences across Oenothera species, researchers should consider several important factors:

  • Selection Pressure Analysis:

    • Calculate Ka/Ks ratios (non-synonymous/synonymous substitution rates) to identify regions under positive or purifying selection.

    • Studies on Oenothera plastomes have employed this approach for protein-coding genes, revealing varied selective pressures across different genes .

    • Exclude highly repetitive regions (as found in ycf1, ycf2, and accD) that can complicate alignment and rate calculations .

  • Structural-Functional Domain Analysis:

    • Map sequence variations to known functional domains:

      • Transmembrane regions

      • Interaction surfaces with PSI components

      • Oligomerization domains

    • Changes in conserved regions likely impact function more significantly than those in variable regions.

  • Comparative Phylogenetic Analysis:

    • Generate phylogenetic trees using multiple methods (Neighbor-Joining, Maximum-Likelihood, Maximum Parsimony) as done for Oenothera plastomes .

    • Bootstrap analysis (1000+ replicates) should be performed to assess tree reliability.

    • Compare gene-specific trees with species trees to identify potential horizontal gene transfer or incomplete lineage sorting.

  • Statistical Approaches for Sequence Comparison:

    • Use appropriate statistical tests when comparing sequence divergence between species.

    • Consider multiple testing corrections when analyzing large datasets.

    • Employ sliding window analysis to identify regions of accelerated evolution.

  • Integration with Plastome-Genome Incompatibility Data:

    • Correlate sequence variations with known incompatibility combinations.

    • Test whether Ycf4 variants cluster according to compatibility groups.

    • Consider co-evolution with nuclear-encoded interaction partners.

The evolutionary analysis of Ycf4 in Oenothera is particularly valuable given the genus's unique suitability for studying molecular mechanisms of speciation and the role of plastid genes in reproductive isolation . By carefully applying these analytical approaches, researchers can gain insights into the potential role of Ycf4 variations in plastome-genome incompatibility and speciation processes.

What technical challenges must be overcome when studying protein-protein interactions involving Ycf4 in Oenothera elata subsp. hookeri?

Studying protein-protein interactions involving Ycf4 presents several technical challenges that researchers must address:

  • Membrane Protein Solubilization Optimization:

    • Challenge: Ycf4 is a thylakoid membrane protein with hydrophobic domains that can aggregate during extraction.

    • Solution: Systematic testing of detergent types (DDM, digitonin, CHAPS) and concentrations to maintain native structure while achieving solubilization.

    • Validation: Monitor complex integrity using sucrose gradient ultracentrifugation and native gel electrophoresis .

  • Complex Size and Heterogeneity:

    • Challenge: The Ycf4 complex is large (>1500 kD in Chlamydomonas) and may exist in multiple oligomeric states.

    • Solution: Use electron microscopy and single particle analysis to characterize different assembly states, as demonstrated with Chlamydomonas Ycf4 .

    • Validation: Size exclusion chromatography to separate and characterize different complex populations.

  • Transient Interaction Detection:

    • Challenge: Assembly factor interactions may be transient and difficult to capture.

    • Solution: Cross-linking approaches (chemical cross-linkers or photo-cross-linking) to stabilize interactions before purification.

    • Validation: Mass spectrometry to identify cross-linked peptides and interaction interfaces.

  • Distinguishing Direct from Indirect Interactions:

    • Challenge: Co-purification studies cannot distinguish direct from indirect interactions.

    • Solution: Targeted approaches like yeast two-hybrid or split-ubiquitin assays for membrane proteins.

    • Validation: In vitro binding assays with purified components.

  • Species-Specific Adaptations:

    • Challenge: Methods optimized for model organisms may not transfer directly to Oenothera.

    • Solution: Develop Oenothera-specific genetic tools or use heterologous expression systems.

    • Validation: Functional complementation assays to confirm activity of heterologously expressed proteins.

  • Data Analysis Considerations:

    • Challenge: Distinguishing specific interactions from background contamination.

    • Solution: Use quantitative proteomics with appropriate controls and statistical analysis.

    • Validation: Multiple biological replicates and reciprocal pull-down experiments.

By addressing these technical challenges, researchers can generate more reliable data on Ycf4 protein interactions in Oenothera elata subsp. hookeri, leading to better understanding of its role in PSI assembly and potential contributions to plastome-genome incompatibility .

What emerging technologies could advance our understanding of Ycf4 function in Oenothera elata subsp. hookeri?

Several cutting-edge technologies and approaches hold promise for advancing our understanding of Ycf4 function:

  • CRISPR-Based Chloroplast Genome Editing:

    • Direct editing of the plastid ycf4 gene to create targeted mutations.

    • Generation of tagged versions of Ycf4 at the endogenous locus.

    • Creation of conditional knockdowns using inducible systems.

    • This approach would overcome limitations of traditional plastid transformation methods.

  • Cryo-Electron Microscopy (Cryo-EM):

    • High-resolution structural analysis of the Ycf4-containing complex.

    • Visualization of different assembly states and interactions with PSI components.

    • This would build upon previous electron microscopy studies that identified large particle structures (285 × 185 Å) in purified Ycf4 complex preparations .

  • Proximity-Based Labeling Techniques:

    • BioID or APEX2 fusion to Ycf4 to identify proteins in its vicinity in vivo.

    • Temporal mapping of interaction networks during PSI assembly.

    • This approach could reveal transient interactions missed by co-immunoprecipitation.

  • Synthetic Biology Approaches:

    • Design of minimal Ycf4 variants to determine essential functional domains.

    • Creation of hybrid Ycf4 proteins combining domains from compatible and incompatible species.

    • Testing engineered Ycf4 variants in plastome-genome incompatibility contexts.

  • Integrative Multi-Omics:

    • Combining transcriptomics, proteomics, and metabolomics to understand the systemic impact of Ycf4 variants.

    • Correlation of Ycf4 sequence variations with photosynthetic efficiency phenotypes across Oenothera species.

    • This would extend beyond single-protein studies to understand broader physiological implications.

These technologies could be applied to address fundamental questions about Ycf4 function in Oenothera, particularly its potential role in plastome-genome incompatibility, which represents a unique aspect of Oenothera biology and evolution .

How might understanding Ycf4 function contribute to broader research on plastid evolution and speciation mechanisms?

Understanding Ycf4 function in Oenothera elata subsp. hookeri has significant implications for broader research on plastid evolution and speciation:

  • Cytonuclear Co-evolution:

    • Ycf4 interacts with nuclear-encoded PSI assembly factors, making it an excellent model for studying co-evolution between plastid and nuclear genomes.

    • Analysis of these interactions could reveal selection pressures driving speciation through plastome-genome incompatibility.

    • The Oenothera system, with its well-characterized plastome types (I-V) and nuclear genomes (A, B, C), provides a unique opportunity to study this co-evolution in a natural context .

  • Molecular Basis of Reproductive Isolation:

    • In Oenothera, hybrid incompatibility primarily manifests through chloroplast-nuclear genome interactions, with viable offspring displaying incompatibility between the chloroplast and nuclear genomes .

    • Understanding how Ycf4 variants contribute to these incompatibilities could provide mechanistic insights into this form of reproductive isolation.

    • This could illuminate how organellar genes can drive speciation, a less-studied aspect of evolutionary biology.

  • Photosynthetic Adaptation During Speciation:

    • Differences in photosynthetic efficiency between species may reflect adaptation to different environmental conditions.

    • Ycf4 variants could contribute to these adaptations through altered PSI assembly efficiency.

    • Correlating Ycf4 sequence variations with photosynthetic phenotypes across Oenothera species could reveal selection pressures driving functional diversification.

  • Organellar Genome Evolution:

    • The conservation of ycf4 in plastid genomes across diverse photosynthetic eukaryotes suggests its fundamental importance.

    • Understanding why this gene has remained plastid-encoded rather than being transferred to the nucleus (like many other original plastid genes) could provide insights into constraints on organellar genome evolution.

    • The varying essentiality of Ycf4 across lineages (essential in eukaryotes, non-essential in cyanobacteria) reflects evolutionary changes in photosynthetic machinery assembly .

By focusing on Ycf4 function in Oenothera, researchers can contribute to these broader questions in evolutionary biology, potentially revealing general principles about how organellar genes contribute to speciation and adaptation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.