Recombinant Oenothera elata subsp. hookeri Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Production and Characterization

The recombinant CP47 is produced under optimized conditions to ensure stability and functionality:

  • Storage: Lyophilized in Tris/PBS buffer with 6% trehalose (pH 8.0) at -20°C/-80°C .

  • Reconstitution: Requires gentle centrifugation and reconstitution in sterile water (0.1–1.0 mg/mL), with glycerol (5–50%) for long-term storage .

Functional Purity

  • Validated via SDS-PAGE and spectroscopic analyses .

  • Co-purifies with auxiliary subunits (PsbH, PsbL, PsbT) in native configurations .

Role in Photosystem II Assembly

  • CP47 forms preassembled pigment-protein complexes in vivo before integrating into PSII .

  • Binds 16 chlorophyll a molecules and 4 β-carotenes, critical for light absorption and energy transfer .

Regulation of the psbB Operon

  • In Oenothera, the psbB operon (psbB, psbT, psbH, petB, petD) is light-regulated. A 144 bp deletion 7 bp upstream of the -35 promoter box disrupts transcription under high light (HL), impairing PSII biogenesis .

  • This deletion reduces psbB operon transcription by 50–80% in incompatible hybrids, linking plastid-nuclear incompatibility to PSII dysfunction .

Hybrid Incompatibility

  • Mismatches between Oenothera elata subsp. hookeri plastomes and nuclear genomes (e.g., AB-I hybrids) cause chlorophyll deficiency under HL due to:

    • Downregulation of pbf1 (a PSII assembly factor) .

    • Reduced cytochrome b₆f accumulation (80% of wild type) .

Functional Significance

  • Biotechnological Applications: Recombinant CP47 enables structural studies of PSII and engineering of stress-tolerant crops .

  • Evolutionary Insights: The psbB operon’s promoter region is a hotspot for speciation in Oenothera, driving reproductive isolation via chloroplast-nuclear incompatibilities .

Comparative Analysis

The Oenothera CP47 shares 85% sequence identity with rice (Oryza sativa) CP47 (UniProt: P0C362) , but its light-dependent regulatory mechanisms are unique to Oenothera’s evolutionary adaptations .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the order method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please specify this in your order for prioritized development.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Oenothera elata subsp. hookeri (Hooker's evening primrose) (Oenothera hookeri)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLAVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTVTNPGIWSYEGVAGSHILFSGLCFLAAIWHWVYWDL AIFSDERTGKPSLDLPKIFGIHLFLSGLACFGFGAFHVTGLYGPGIWVSDPYGLTGEVQP VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVGAGLAKNQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDSGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTIEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDTQVEFGAFQKLGDPTTRRQAV
Uniprot No.

Target Background

Function
A core component of the Photosystem II (PSII) complex. It binds chlorophyll and facilitates the primary light-driven photochemical reactions of PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from H₂O, producing O₂ and a proton gradient for subsequent ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Photosystem II CP47 chlorophyll apoprotein (psbB) and what is its functional role in photosynthesis?

The Photosystem II CP47 chlorophyll apoprotein (psbB) is an integral component of the photosynthetic apparatus, also known as the PSII 47 kDa protein or Protein CP-47. It functions as one of the primary antenna complexes in Photosystem II, responsible for efficient excitation energy transfer to the PSII reaction center. CP47 contains multiple chlorophyll molecules that capture light energy and transfer it to the reaction center, where charge separation initiates the electron transfer cascade that drives oxygenic photosynthesis .

The protein plays a crucial role in the structural organization of PSII and contributes significantly to the stability of the entire complex. The excitation energy transfer properties of CP47 are essential for the initial steps of photosynthesis, making it a key protein for understanding photosynthetic efficiency and regulation .

Why is Oenothera elata subsp. hookeri used as a model organism for studying psbB?

Oenothera elata subsp. hookeri (Hooker's evening primrose) has emerged as a valuable model organism for studying psbB for several scientific reasons. This plant species exhibits unique genetic characteristics, particularly in its plastome organization and expression patterns, which facilitate the study of chloroplast gene regulation and function.

Importantly, Oenothera species form natural hybrids with distinct nuclear-plastome combinations (e.g., AA-I, AA-II, AB-I, AB-II), providing natural genetic variations that reveal important regulatory mechanisms. These hybrids show differential light-dependent regulation of the psbB operon, particularly when the plastome I is present in the AB background . The conservation of promoter sequences between species, despite functional differences, makes Oenothera particularly valuable for comparative genomic studies of photosynthetic regulation .

Additionally, the well-characterized transcription start sites and promoter elements in Oenothera allow researchers to precisely study how sequence variations affect gene expression and protein assembly in different genetic backgrounds and under various environmental conditions.

What expression systems are commonly used for producing recombinant psbB protein?

Multiple expression systems have been developed for the production of recombinant Oenothera elata subsp. hookeri Photosystem II CP47 chlorophyll apoprotein, each with distinct advantages depending on research requirements. The following expression systems are predominantly used:

Expression SystemProduct CharacteristicsAdvantagesCommon Applications
E. coli>85% purity (SDS-PAGE)High yield, cost-effective, rapid productionStructural studies, antibody production
E. coli with Avi-tag BiotinylationBiotinylated protein via BirA technologySite-specific biotin attachment for detection and purificationProtein-protein interaction studies, pull-down assays
YeastPost-translational modificationsMore complex folding environment than E. coliFunctional studies requiring eukaryotic processing
BaculovirusInsect cell expressionHigh expression of membrane proteinsStructural and functional studies
Mammalian cellNative-like modificationsMost natural folding environmentStudies requiring authentic protein modifications

All expression systems typically produce the protein with purity levels exceeding 85% as determined by SDS-PAGE analysis . The selection of an appropriate expression system should be guided by the specific experimental requirements, particularly whether native folding, post-translational modifications, or high yield are prioritized.

How does the deletion in the psbB operon promoter affect light-dependent regulation in Oenothera hybrids?

The psbB operon promoter deletion in Oenothera hybrids presents a fascinating case study in nuclear-plastome compatibility and light-dependent regulation. The deletion specifically affects regulation in a genetic background-dependent manner, with the most pronounced effects observed in AB-I plants (nuclear genome AB with plastome I).

Research has demonstrated that while the same promoter is utilized across all genetic backgrounds (AA-I, AA-II, AB-I, AB-II), as confirmed by transcription start site mapping, the deletion's functional consequences are only manifest in the incompatible AB-I hybrids . Notably, the deletion is positioned 7 base pairs upstream of the -35 box and does not affect the TATA box of the psbB operon promoter .

The light-dependent nature of this regulatory defect is particularly significant. Under high light (HL) conditions, AB-I incompatible plants show distinctive expression patterns compared to their green counterparts (AA-I, AA-II, and AB-II) . This suggests that the deletion does not directly impair RNA polymerase binding but likely affects the interaction with auxiliary proteins such as sigma factors that mediate light-responsive transcription .

The mechanism likely involves altered binding of light-responsive transcription factors or sigma subunits of RNA polymerase to the modified promoter region. Researchers investigating this phenomenon should consider chromatin immunoprecipitation (ChIP) assays to identify differential protein binding at the promoter under varying light conditions.

What methodological approaches are most effective for studying interactions between assembly factors and CP47?

Several complementary methodological approaches have proven effective for investigating interactions between assembly factors (such as Psb28) and CP47:

  • Chemical Cross-linking with Mass Spectrometry
    This approach has successfully identified that Psb28 binds to the cytosolic side of CP47, near cytochrome b559 and the QB binding site . The technique involves using cross-linking reagents that create covalent bonds between interacting proteins, followed by proteolytic digestion and mass spectrometric analysis to identify cross-linked peptides.

  • Nuclear Magnetic Resonance (NMR) Spectroscopy
    NMR spectroscopy, particularly chemical shift perturbation (CSP) experiments, has been employed to characterize the interaction between recombinant Psb28 and synthetic peptides of the conserved CP47 C-terminus . This approach allows for the determination of dissociation constants (Kd) and provides atomic-level insights into binding interfaces.

  • Cryo-Electron Microscopy (Cryo-EM)
    Structural studies have revealed that the binding of Psb28 to the C-terminus of CP47 induces the formation of an extended β-hairpin structure incorporating the central antiparallel β-sheet of Psb28, the C-terminus of CP47, and the D1 D-E loop . This methodology has been instrumental in understanding how Psb28 binding imparts directionality to the assembly process.

  • Isolation of Tagged Assembly Factors
    The interaction of assembly factors like Psb34 with PSII intermediates has been confirmed by isolating Strep-tagged proteins from unmodified cells . This approach helps identify specific functions of assembly factors in the attachment of components like CP43 to RC47 complexes.

Each of these methodologies provides unique insights, and a comprehensive understanding of CP47 interactions typically requires their combined application.

How do FPB1 and PAM68 proteins cooperatively assist in CP47 integration during PSII assembly?

The cooperative role of FPB1 and PAM68 in CP47 integration represents a sophisticated co-translational mechanism critical for PSII assembly. These proteins function synergistically during the translation and membrane integration of CP47, particularly at a critical juncture when the last transmembrane domain (TMD) segment emerges from the ribosomal tunnel.

Studies of fpb1 and pam68 mutants have revealed that ribosome elongation pauses at this specific point during psbB translation . This translational pausing appears to be a regulated checkpoint rather than a defect, allowing proper integration of this complex membrane protein. The mechanism involves interactions between FPB1, PAM68, the Alb3 integrase, and components of the SecY/E system .

Experimental evidence indicates that the ribosomal machinery responsible for CP47 synthesis is physically associated with both FPB1 and PAM68 . Polysome analysis has shown a significant shift of psbB-containing transcripts to higher molecular weight fractions in fpb1 mutants compared to wild type, suggesting altered ribosome association or translation dynamics . This association was confirmed to be authentic through puromycin treatment, which caused shifts toward lower molecular weight fractions .

Importantly, this cooperative mechanism appears to be specific to CP47 synthesis and integration, as the translation of other photosystem components remains largely unaffected in the mutants. For instance, synthesis of PsbH, which can influence CP47 synthesis in other contexts, remains comparable to wild type in fpb1 mutants .

Researchers investigating this process should consider employing ribosome profiling, co-immunoprecipitation of translation complexes, and in vitro translation systems to further elucidate the precise molecular mechanisms of this cooperation.

What techniques are employed to study CP47 chlorophyll excitation energies?

Advanced quantum mechanical approaches have revolutionized the study of CP47 chlorophyll excitation energies, providing unprecedented insights into the electronic properties that govern light harvesting and energy transfer. The methodological approach combines several sophisticated techniques:

  • Multiscale Quantum Mechanics/Molecular Mechanics (QM/MM) Approach
    This comprehensive computational method has been successfully employed to compute the excitation energies of all 16 chlorophyll molecules in CP47 within a complete membrane-embedded cyanobacterial PSII dimer . The approach integrates:

    • Full time-dependent density functional theory

    • Modern range-separated functionals

    • Explicit modeling of the protein environment effects on chlorophyll excitation

  • Electrostatic Effect Quantification
    The methodology quantifies the critical electrostatic effect of the protein environment on the site energies of individual chlorophylls . This is essential for understanding the energy landscape that directs excitation energy transfer through the antenna complex to the reaction center.

  • Membrane-Embedded Full Complex Analysis
    Rather than studying isolated chlorophylls or simplified models, current state-of-the-art approaches analyze the CP47 antenna within the context of a complete PSII dimer embedded in a membrane environment . This comprehensive approach captures the authentic structural context that influences excitation energies.

What are the regulatory requirements for research involving recombinant psbB protein?

Research involving recombinant Oenothera elata subsp. hookeri Photosystem II CP47 chlorophyll apoprotein (psbB) must adhere to established regulatory frameworks for recombinant DNA research. The NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules provide the primary regulatory structure in the United States, categorizing experiments based on their potential risks .

For most research involving recombinant psbB, experiments would likely fall under Section III-D or III-E of the NIH Guidelines, requiring Institutional Biosafety Committee (IBC) approval before initiation . The specific category depends on:

  • The host-vector systems used for expression

  • The source and nature of the DNA being manipulated

  • The containment conditions employed

Key regulatory considerations include:

  • Risk Group Assessment: Determine the appropriate risk group classification for the host organisms used in expression systems

  • Containment Level: Implement physical and biological containment measures appropriate to the risk assessment

  • IBC Approval: Obtain approval from the institutional biosafety committee before initiating experiments

  • Documentation: Maintain thorough records of experimental procedures, risk assessments, and containment measures

What approaches can be used to analyze polysome association with psbB transcripts?

  • Sucrose Density Gradient Ultracentrifugation
    This is the gold standard technique for polysome profiling and has been successfully employed to demonstrate significant shifts of psbB-containing transcripts to higher molecular weight fractions in mutants like fpb1 . The procedure involves:

    • Cell lysis under conditions that preserve polysome integrity

    • Separation of cellular components on a 10-50% sucrose gradient

    • Fractionation and analysis of RNA distribution across the gradient

    • Northern blot or qRT-PCR analysis of specific transcripts in each fraction

  • Puromycin Treatment Verification
    To confirm that high molecular weight fractions truly represent polysome-associated mRNAs rather than other ribonucleoprotein complexes, samples can be treated with puromycin, a ribosome-specific disassembler . Authentic polysome-associated transcripts will shift to lower molecular weight fractions following puromycin treatment.

  • Comparative Analysis Across Transcripts
    To identify transcript-specific effects, researchers should analyze multiple chloroplast-encoded transcripts simultaneously. For instance, studies have shown that while psbB transcripts show altered polysome association in fpb1 mutants, other transcripts like psbA, psbC, psbD, psbEFLJ, and psbKI show no significant differences in distribution .

  • Ribosome Footprinting
    This advanced technique can provide nucleotide-resolution information about ribosome positioning on mRNAs, potentially identifying specific pausing sites during translation of the psbB transcript.

These methodologies allow researchers to determine whether observed phenotypes result from altered transcription, translation initiation, or translation elongation of specific photosystem components.

How can structural insights into CP47 assembly factors advance our understanding of PSII biogenesis?

Recent structural studies of CP47 assembly factors have revealed previously unknown molecular mechanisms governing PSII biogenesis. The structural characterization of assembly factors like Psb28, Psb27, and Psb34 has provided crucial insights that can advance PSII research in several directions:

  • Directionality of Assembly Process
    The binding of Psb28 to the C-terminus of CP47 has been shown to impart directionality to the assembly process . In Psb28-free complexes (PSII-M), the CP47 C-terminus blocks the Psb28 binding site by interacting with the D1 D-E loop, preventing the reverse process and protecting active PSII from perturbation by Psb28 . This mechanism ensures the unidirectional progression of assembly.

  • Protection from Photodamage During Assembly
    Structural studies indicate that Psb28 binding to the cytosolic side of CP47, close to cytochrome b559 and the QB binding site, serves to block electron transport to the acceptor side of PSII . This protective role shields the RC47 complex from excess photodamage during the assembly process. The protective function is further supported by observations that Psb28 is also found in PSII repair complexes .

  • Integration of Novel Assembly Factors
    Advanced structural approaches have enabled the identification of previously overlooked assembly factors like Psb34, which binds to the CP47 antenna protein in proximity to PsbH . Its conserved long N-terminal arm is located at the side and top of the D2 subunit, suggesting a role in stabilizing this region during assembly .

Future research should focus on integrating these structural insights with functional studies to develop comprehensive models of PSII assembly, potentially leading to applications in enhancing photosynthetic efficiency or engineering synthetic photosystems with improved characteristics.

What are the experimental challenges in studying light-dependent regulation of the psbB operon?

Investigating the light-dependent regulation of the psbB operon presents several experimental challenges that researchers must address through careful experimental design:

  • Isolating Genetic Background Effects from Light-Dependent Responses
    The complex interplay between nuclear and plastid genomes complicates the analysis of light-dependent regulation. In Oenothera, the deletion in plastome I affects regulation of the psbB operon promoter in a light-dependent manner specifically in the AB background, but not in the AA background . Experimental designs must carefully control for genetic background effects by using appropriate controls and genetic combinations.

  • Temporal Dynamics of Light Responses
    Light-dependent regulation operates across multiple time scales, from rapid photochemical responses to slower transcriptional adaptation. Kinetic studies with appropriate time resolution are essential for distinguishing between immediate signaling events and longer-term adaptive responses.

  • Distinguishing Direct from Indirect Effects
    Changes in light conditions affect numerous cellular processes, potentially creating indirect effects on psbB expression. Determining whether regulatory effects are direct responses to light signaling or secondary consequences of altered photosynthetic activity requires sophisticated experimental controls and molecular approaches such as:

    • Time-resolved transcriptomics

    • Chromatin immunoprecipitation to identify transcription factor binding

    • In vitro transcription systems with purified components

    • Site-directed mutagenesis of specific promoter elements

  • Integration of Transcriptional and Post-Transcriptional Regulation
    Light affects both transcription and post-transcriptional processes like RNA stability and translation. A comprehensive understanding requires integrating data from multiple regulatory levels using techniques like polysome profiling, RNA stability assays, and protein synthesis measurements.

By addressing these challenges through multifaceted experimental approaches, researchers can develop more complete models of how light signals are integrated to regulate photosystem assembly and function.

What emerging technologies might advance research on recombinant psbB?

Several cutting-edge technologies are poised to transform research on recombinant Oenothera elata subsp. hookeri Photosystem II CP47 chlorophyll apoprotein (psbB):

  • Cryo-Electron Tomography
    This technique could enable visualization of CP47 integration into developing thylakoid membranes within intact chloroplasts, providing unprecedented insights into the spatial and temporal aspects of PSII assembly in near-native conditions.

  • Single-Molecule Fluorescence Resonance Energy Transfer (smFRET)
    Application of smFRET to study energy transfer dynamics in individual CP47 complexes would allow direct observation of conformational changes and interaction kinetics with assembly factors under varying environmental conditions.

  • In Situ Structural Biology
    Emerging approaches combining genetic code expansion with in-cell crosslinking and mass spectrometry could map the changing interaction network of CP47 throughout the assembly process within living cells.

  • Artificial Intelligence for Protein Structure Prediction
    Advanced protein structure prediction algorithms could accelerate the design of modified CP47 variants with altered spectral properties or enhanced stability, potentially leading to applications in synthetic biology and bioenergy research.

These technological advances, coupled with continued refinement of classical approaches, promise to address fundamental questions about PSII assembly and function, potentially leading to applications in improving photosynthetic efficiency and developing bio-inspired solar energy conversion systems.

How might climate change research benefit from studies of psbB light-dependent regulation?

Understanding the light-dependent regulation of psbB has significant implications for climate change research, particularly in predicting and potentially enhancing plant responses to changing environmental conditions:

  • Adaptability to Fluctuating Light Conditions
    Climate change is expected to increase weather variability, resulting in more frequent fluctuations in light intensity. The regulatory mechanisms governing psbB expression under varying light conditions provide insights into how photosynthetic organisms sense and adapt to such fluctuations, potentially informing strategies to enhance resilience.

  • Thermal Tolerance of Photosynthesis
    Rising global temperatures affect the stability and function of photosynthetic complexes. Research on the structural stability of CP47 under various conditions could help identify genetic variants with enhanced thermal tolerance or guide the engineering of more heat-resistant photosystems.

  • Efficiency Under Suboptimal Conditions Studies of how psbB regulation contributes to photosynthetic efficiency under various stress conditions can inform crop improvement strategies aimed at maintaining productivity under increasingly challenging climatic conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.