Recombinant Oenothera elata subsp. hookeri Photosystem II D2 protein (psbD)

Shipped with Ice Packs
In Stock

Description

Biological Role in Photosystem II

The D2 protein partners with D1 to form the PSII reaction center heterodimer, enabling:

  • Electron transfer via plastoquinone (Qₐ and Qᴃ) .

  • Photoprotection by regulating reactive oxygen species .

  • Assembly intermediates stabilized by chaperones like Psb28 and Ycf48 during biogenesis .

Structural studies reveal that psbD undergoes conformational changes during PSII assembly, particularly in the Qᴃ-binding region, which is essential for water splitting .

Functional Studies

  • Mutational Analysis: Single amino acid substitutions in psbD disrupt PSII stability, as shown in Oenothera hybrids with impaired photosynthesis .

  • Incompatibility Phenotypes: Deletions in the plastid clpP/psbB spacer region linked to psbD dysfunction cause hybrid inviability in Oenothera .

Evolutionary and Ecological Context

  • PsbD is highly conserved across Oenothera plastomes, with inversions in rbcL-accD and rps16-trnQ regions influencing speciation .

  • Subplastome variations in psbD correlate with environmental adaptations in Oenothera populations .

Challenges and Future Directions

  • Stability Issues: Repeated freeze-thaw cycles degrade the protein .

  • Functional Studies: Further research is needed to map psbD’s role in Mn₄CaO₅ cluster incorporation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, serving as a reference for your convenience.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbD; Photosystem II D2 protein; PSII D2 protein; Photosystem Q(A protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Oenothera elata subsp. hookeri (Hooker's evening primrose) (Oenothera hookeri)
Target Names
psbD
Target Protein Sequence
MTIALGKFTKDEKDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGA FALIGFMLRQFEIARSVQLRPYNAIAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to abstract electrons from H2O, generating O2 and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex responsible for photon capture and an electron transfer chain that converts photonic excitation into a charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors. D2 is essential for the assembly of a stable PSII complex.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Photosystem II D2 protein and what role does it play in photosynthesis?

The Photosystem II D2 protein (psbD) is one of the core proteins of the photosystem II reaction center. Working in conjunction with the D1 protein, it forms the heterodimeric core of PSII where primary photochemistry occurs. Photosystem II uses light energy to remove electrons from water, resulting in the release of oxygen as a byproduct of this water-splitting reaction . The D2 protein contains binding sites for electron transfer cofactors and participates in the creation of the redox potential necessary for water oxidation. In Oenothera elata subsp. hookeri, this protein consists of 353 amino acids and functions as an integral component of the thylakoid membrane protein complex . The protein's structure is highly conserved across photosynthetic organisms, highlighting its fundamental importance in the photosynthetic apparatus.

How does the recombinant form of the psbD protein differ from the native protein?

The recombinant form of the Oenothera elata subsp. hookeri psbD protein available for research contains an N-terminal His-tag, which facilitates purification using affinity chromatography techniques . This modification allows for high-purity isolation but introduces structural differences from the native protein. The recombinant protein is typically expressed in E. coli expression systems rather than in the original plant chloroplast environment .

The key differences include:

PropertyNative psbDRecombinant psbD
Expression systemPlant chloroplastE. coli bacterial system
Protein tagsNoneN-terminal His-tag
Post-translational modificationsContains plant-specific modificationsLacks plant-specific modifications
Membrane integrationIntegrated in thylakoid membraneTypically purified in detergent micelles
Cofactor associationAssociated with chlorophylls, quinones, and other cofactorsOften purified without native cofactors

These differences can affect protein folding, stability, and functionality in experimental settings and must be considered when designing experiments and interpreting results .

What are the optimal conditions for reconstitution and storage of recombinant psbD protein?

For optimal reconstitution of lyophilized recombinant Oenothera elata subsp. hookeri psbD protein, researchers should follow this methodology:

  • Centrifuge the vial briefly before opening to ensure all material is at the bottom.

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Add glycerol to a final concentration of 50% to enhance protein stability during storage.

  • Aliquot the solution into smaller volumes to avoid repeated freeze-thaw cycles.

For storage:

  • Short-term storage (up to one week): Store working aliquots at 4°C.

  • Long-term storage: Maintain at -20°C or preferably -80°C.

  • Avoid repeated freeze-thaw cycles as they can lead to protein denaturation and loss of activity .

The protein is typically supplied in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain stability during lyophilization . When designing experiments, researchers should consider that the storage buffer components may affect certain assays and adjust protocols accordingly.

What expression systems have been optimized for producing functional recombinant psbD protein?

While E. coli is the most commonly used expression system for recombinant Oenothera elata subsp. hookeri psbD protein production , researchers studying photosystem proteins have developed several expression strategies to enhance functionality:

Expression SystemAdvantagesChallengesYield
E. coliHigh yield, simple genetics, rapid growthLacks chloroplast-specific chaperones, no post-translational modifications10-30 mg/L
CyanobacteriaNative-like environment, cofactor incorporationLower yield, slower growth1-5 mg/L
Chloroplast transformationNative post-translational modificationsComplex transformation, species limitationsVariable
Cell-free systemsMembrane protein compatibility, rapid productionHigher cost, smaller scale0.5-2 mg/mL

For E. coli expression, codon optimization is critical, as plant chloroplast genes often contain codons rarely used in E. coli. Fusion partners such as MBP or SUMO can increase solubility. For functional studies, co-expression with chloroplast-specific chaperones or reconstitution into liposomes post-purification may be necessary to achieve proper folding and function .

How can researchers verify the functional activity of recombinant psbD protein in experimental settings?

Verification of recombinant psbD functionality requires multiple complementary approaches:

  • Spectroscopic analysis:

    • Measure chlorophyll binding through absorption spectroscopy (if reconstituted with chlorophyll)

    • Circular dichroism to assess secondary structure

    • Fluorescence spectroscopy to examine energy transfer capabilities

  • Electron transfer measurements:

    • Oxygen evolution assays using artificial electron acceptors

    • EPR spectroscopy to assess redox-active cofactor binding

    • Flash-induced absorption changes to measure electron transfer kinetics

  • Binding assays:

    • Isothermal titration calorimetry to measure quinone binding

    • Surface plasmon resonance to assess interactions with other PSII components

  • Functional complementation:

    • Transformation of the recombinant protein into psbD-deficient mutants of cyanobacteria or algae to assess rescue of photosynthetic phenotypes

  • Structural integrity validation:

    • Limited proteolysis to assess proper folding

    • Native gel electrophoresis to examine complex formation

A comprehensive functional assessment would typically include multiple techniques from this list to establish with confidence that the recombinant protein retains native-like properties .

How do psbD gene duplications affect photosystem II assembly and function?

The phenomenon of psbD gene duplication, as observed in cyanobacteria like Synechococcus sp. strain PCC 7942, presents an intriguing research area with implications for understanding photosystem II (PSII) evolution and regulation. In Synechococcus, two functional copies of the psbD gene exist: psbDI, which overlaps with psbC (encoding CP43), and psbDII, which is monocistronic .

Research methodologies to investigate the functional significance of these duplications include:

  • Gene inactivation studies: Targeted mutagenesis can be employed to inactivate individual psbD genes. Studies show that while psbDII is dispensable under standard laboratory conditions, psbDI inactivation is typically lethal unless psbC is expressed from an alternate locus .

  • Quantitative protein analysis: Western immunoblotting reveals that strains relying solely on psbDII expression (with psbDI inactivated) produce reduced levels of both D2 and CP43 proteins compared to wild-type cells .

  • Competitive growth experiments: When mutants expressing only psbDII are grown in mixed cultures with wild-type cells, they demonstrate reduced fitness, forming smaller colonies and competing poorly .

These findings suggest that while gene redundancy provides a safeguard for essential photosynthetic function, the expression levels achieved from different genetic contexts significantly impact photosynthetic efficiency and organismal fitness. The coordination between psbD and psbC expression appears particularly critical for optimal PSII assembly and function .

What methods can be used to study the interaction between psbD and other photosystem II components?

Investigating the interactions between the psbD-encoded D2 protein and other PSII components requires sophisticated methodological approaches:

  • Cross-linking coupled with mass spectrometry (XL-MS):

    • Proteins in close proximity can be chemically cross-linked

    • Digestion followed by MS/MS analysis identifies interaction sites

    • Zero-length cross-linkers like EDC or longer-range linkers like DSS provide different spatial information

  • Cryo-electron microscopy (cryo-EM):

    • Near-atomic resolution structures of entire PSII complexes

    • Sample preparation involves purification in detergent micelles or reconstitution into nanodiscs

    • Classification algorithms can identify multiple conformational states

  • Förster Resonance Energy Transfer (FRET):

    • Site-specific labeling of D2 and potential interaction partners with fluorophore pairs

    • Measurements in reconstituted systems or in vivo with genetically encoded tags

    • Provides dynamic information on protein-protein distances

  • Co-immunoprecipitation with targeted mutations:

    • Systematic mutagenesis of putative interaction surfaces on D2

    • Pull-down assays to assess effects on complex formation

    • Western blotting to quantify binding partner retention

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Detects changes in solvent accessibility upon complex formation

    • Identifies regions involved in protein-protein interactions

    • Time-resolved measurements can capture assembly dynamics

These methods can be particularly valuable for understanding how mutations in psbD affect the assembly and stability of the PSII complex, providing insights into photosynthetic efficiency and stress responses .

How do site-directed mutations in conserved regions of psbD affect electron transfer kinetics?

Site-directed mutagenesis of conserved regions in the psbD gene provides valuable insights into structure-function relationships within Photosystem II. Methodological approaches to assess the impact of such mutations include:

  • Target selection strategy:

    • Identify conserved residues through multiple sequence alignments across diverse photosynthetic organisms

    • Focus on residues near cofactor binding sites based on structural models

    • Prioritize residues implicated in proton transfer pathways or quinone binding

  • Mutagenesis approaches:

    • Point mutations to alter chemical properties (e.g., D→N to remove charge)

    • Conservative substitutions to test steric requirements

    • Introduction of unnatural amino acids for specialized biophysical studies

  • Electron transfer kinetics measurement:

    • Time-resolved optical spectroscopy to monitor specific electron transfer steps

    • Flash photolysis coupled with absorption spectroscopy at diagnostic wavelengths

    • Temperature dependence studies to determine activation energies

  • Data analysis framework:

    • Fitting of kinetic traces to multi-exponential decay functions

    • Marcus theory analysis to extract reorganization energies

    • Comparison with molecular dynamics simulations

Mutation TypeTypical Effect on Electron TransferAssessment Method
Quinone-binding pocketAltered QA→QB transfer ratesThermoluminescence, fluorescence decay
Redox-active tyrosinesImpaired water oxidationOxygen evolution, EPR spectroscopy
Chlorophyll-coordinatingChanged primary charge separationUltrafast spectroscopy
Proton channelsSlowed S-state transitionsTime-resolved FTIR

These approaches allow researchers to dissect the precise roles of specific amino acids in the complex electron transfer processes that enable water oxidation in Photosystem II .

How does the Oenothera elata psbD protein sequence compare with other plant species and what evolutionary insights can be gained?

Comparative analysis of the Oenothera elata subsp. hookeri psbD protein sequence with orthologs from diverse photosynthetic organisms reveals patterns of conservation and divergence that reflect evolutionary pressures on photosystem II function:

The psbD protein from Oenothera elata (UniProt ID: Q9MTN1) contains 353 amino acids and shares high sequence identity with psbD proteins from other plants, typically 95-99% among angiosperms . This extraordinary conservation reflects the fundamental importance of the D2 protein in photosynthesis.

Methodological approach for comparative analysis:

  • Multiple sequence alignment using MUSCLE or CLUSTAL algorithms

  • Calculation of sequence identity/similarity matrices

  • Phylogenetic tree construction using maximum likelihood methods

  • Identification of conserved domains and variable regions

  • Mapping of conservation scores onto structural models

Key findings from such analyses include:

Taxonomic GroupSequence Identity to O. elata psbDNotable Differences
Other eudicots97-99%Minimal variation, primarily in N/C termini
Monocots95-97%Minor variations in loop regions
Gymnosperms90-93%Several substitutions in transmembrane helices
Ferns88-91%Differences in quinone-binding regions
Mosses85-88%Extended loop regions
Algae80-85%Variable N-terminal domain
Cyanobacteria75-82%Significant differences in loop regions

The high conservation of psbD across diverse photosynthetic lineages spanning billions of years of evolution underscores the stringent functional constraints on this protein. Variation in specific regions, particularly transmembrane helix-connecting loops, may reflect adaptations to different light environments or regulatory mechanisms .

What insights can be gained from studying psbD gene duplication in different photosynthetic organisms?

The presence of multiple psbD gene copies, as documented in cyanobacteria like Synechococcus sp. strain PCC 7942, offers a valuable research model for understanding gene duplication as an evolutionary mechanism in photosynthetic systems .

Methodological approaches for studying gene duplication effects include:

  • Comparative genomics:

    • Whole genome sequencing of diverse photosynthetic organisms

    • Identification of single-copy versus duplicated psbD genes

    • Analysis of genomic context (gene neighborhood conservation)

    • Dating duplication events through molecular clock analyses

  • Differential expression analysis:

    • RNA-seq under various environmental conditions (light intensity, nutrient limitation, temperature stress)

    • Promoter analysis to identify differential regulatory elements

    • Quantitative proteomics to correlate transcript and protein levels

  • Functional differentiation assessment:

    • Creation of chimeric genes to identify functionally divergent domains

    • Reciprocal complementation studies between species

    • Stress response phenotyping of mutants lacking specific gene copies

Research findings demonstrate that psbD gene duplications can serve multiple adaptive functions:

  • Ensuring adequate expression levels of this critical protein

  • Enabling differential regulation under varying environmental conditions

  • Providing redundancy to maintain function during DNA damage events

  • Allowing subfunctionalization where different copies specialize for different conditions

In Synechococcus, while psbDII appears dispensable under standard laboratory conditions, strains relying solely on this gene copy demonstrate reduced fitness and altered competitive abilities, suggesting subtle functional differences between the duplicated genes . These differences might be more pronounced under specific environmental stresses not typically encountered in laboratory settings.

How do structural homology models of plant psbD compare to bacterial reaction center structures, and what are the limitations of these models?

Methodological approach for homology modeling:

  • Template selection:

    • Crystal structures of purple bacterial reaction centers (e.g., Rhodobacter sphaeroides)

    • Available cyanobacterial PSII structures

    • Consideration of sequence identity and structural coverage

  • Alignment optimization:

    • Manual refinement of automated alignments

    • Special attention to conserved residues and secondary structure elements

    • Gap placement in loop regions rather than transmembrane segments

  • Model building and refinement:

    • Generation of initial models using software like MODELLER or SWISS-MODEL

    • Energy minimization with membrane-specific force fields

    • Validation using tools like PROCHECK and VERIFY3D

  • Integration with experimental data:

    • Incorporation of cross-linking constraints

    • Validation against mutagenesis results

    • Refinement based on spectroscopic measurements

Comparative analysis reveals both similarities and critical differences:

The most significant limitation of these homology models is that bacterial reaction centers do not possess the oxygen-evolving complex that characterizes PSII. As noted by researchers, "reaction centres of purple bacteria do not oxidize water" . This fundamental difference means that homology models cannot accurately represent the unique water-splitting apparatus that makes PSII so important in global photosynthesis.

Additionally, these models struggle to accurately represent:

  • Plant-specific loop regions with low sequence conservation

  • Interactions with plant-specific PSII subunits

  • Binding sites for the oxygen-evolving complex

  • Structural changes during the catalytic cycle

Despite these limitations, homology modeling provides valuable initial insights that can guide experimental design, especially when combined with emerging structural data from plant and cyanobacterial systems .

What are common challenges in working with recombinant psbD proteins and how can they be addressed?

Researchers working with recombinant Oenothera elata psbD protein encounter several technical challenges that require specific troubleshooting approaches:

  • Poor solubility and aggregation:

    • Challenge: As a membrane protein, psbD has hydrophobic regions that promote aggregation.

    • Solution: Optimize detergent selection (DDM, LMNG, or amphipols); use fusion tags that enhance solubility; employ co-expression with chaperones; consider cell-free expression systems .

  • Low expression yields:

    • Challenge: Membrane proteins often express poorly in heterologous systems.

    • Solution: Test multiple expression strains; optimize codon usage; reduce expression temperature; use specialized E. coli strains like C41(DE3) or C43(DE3); consider induction at lower cell densities .

  • Improper folding:

    • Challenge: Without the native chloroplast machinery, achieving proper folding is difficult.

    • Solution: Co-express with chloroplast chaperones; use mild solubilization conditions; implement step-wise refolding protocols; validate secondary structure by circular dichroism .

  • Loss of cofactors:

    • Challenge: Purified recombinant protein often lacks native cofactors essential for function.

    • Solution: Develop reconstitution protocols with purified chlorophylls and quinones; verify cofactor binding spectroscopically; consider partial reconstitution approaches focusing on specific binding sites.

  • Storage instability:

    • Challenge: Activity loss during storage due to protein degradation or denaturation.

    • Solution: Store at -80°C with 50% glycerol; avoid freeze-thaw cycles; add stabilizers like trehalose; consider flash-freezing in liquid nitrogen .

ProblemEarly Detection MethodPrevention Strategy
AggregationDynamic light scatteringOptimize detergent:protein ratio
MisfoldingIntrinsic fluorescenceSlow refolding dialysis
ProteolysisSDS-PAGE time courseAdd protease inhibitors
OxidationMass spectrometryInclude reducing agents
Activity lossFunctional assays before/after storageAliquot and minimize freeze-thaw

Implementing quality control checkpoints throughout the purification process is essential for ensuring experimental reproducibility when working with this challenging membrane protein .

How can researchers distinguish between artifacts and genuine results when studying recombinant psbD interactions?

When investigating interactions involving recombinant psbD protein, differentiating between genuine biological interactions and experimental artifacts requires rigorous controls and complementary methodologies:

  • Control strategies for interaction studies:

    • Use non-tagged versions of proteins to control for tag-mediated interactions

    • Include irrelevant proteins of similar size/charge as negative controls

    • Perform competition assays with unlabeled protein to confirm specificity

    • Test interactions in different buffer conditions to ensure robustness

  • Validation through multiple methods:

    • Confirm interactions observed in vitro (e.g., pull-downs) with in vivo approaches (e.g., FRET)

    • Cross-validate physical interactions with functional assays

    • Use both tag-based and antibody-based detection methods

    • Apply structural techniques (cross-linking MS, HDX-MS) to identify interaction interfaces

  • Concentration dependence analysis:

    • Test interactions across a range of protein concentrations

    • Distinguish specific from non-specific interactions through saturation analysis

    • Calculate binding constants and compare with physiological concentrations

    • Use surface plasmon resonance or microscale thermophoresis for quantitative measurements

  • Statistical approaches:

    • Perform sufficient biological and technical replicates (minimum n=3)

    • Apply appropriate statistical tests to interaction data

    • Establish clear thresholds for significant versus background interactions

    • Report effect sizes along with p-values

By implementing these methodological approaches, researchers can substantially increase confidence in reported psbD protein interactions and avoid pursuing artifacts that may arise from the challenging nature of membrane protein biochemistry.

What are the most promising future research directions for psbD protein studies?

The study of recombinant Oenothera elata subsp. hookeri psbD protein continues to evolve, with several promising research directions emerging:

  • Structure-based engineering for enhanced photosynthetic efficiency:

    • Site-directed mutagenesis guided by structural insights to improve electron transfer efficiency

    • Modification of quinone-binding sites to alter redox properties

    • Engineering of D1/D2 interfaces to enhance PSII stability under stress conditions

  • Single-molecule studies of D2 dynamics:

    • Application of advanced fluorescence techniques to monitor conformational changes during the catalytic cycle

    • Correlation of structural dynamics with functional states

    • Investigation of water and proton channels during oxygen evolution

  • Comparative functional genomics across diverse photosynthetic organisms:

    • Expanded analysis of psbD gene duplications and their regulatory mechanisms

    • Investigation of species-specific adaptations in psbD sequences

    • Correlation of sequence variations with ecological niches and environmental stresses

  • Integration of psbD into synthetic biology applications:

    • Development of minimal photosynthetic systems incorporating engineered D2 variants

    • Creation of light-driven biocatalytic systems based on modified PSII components

    • Exploration of novel electron transfer pathways for biotechnology applications

These research directions promise to deepen our understanding of photosynthetic mechanisms while potentially contributing to applications in renewable energy, agricultural productivity, and environmental sustainability. The multidisciplinary nature of this research will require collaboration between structural biologists, biochemists, molecular biologists, and computational scientists to achieve transformative insights into this fundamental component of photosynthesis .

How might advances in structural biology techniques impact our understanding of psbD protein function?

Recent and emerging advances in structural biology technologies promise to revolutionize our understanding of the psbD-encoded D2 protein's function in photosystem II:

  • Cryo-electron microscopy (cryo-EM) advancements:

    • Near-atomic resolution structures of entire photosystem II complexes

    • Time-resolved cryo-EM to capture intermediate states during the catalytic cycle

    • Visualization of PSII in different S-states of the oxygen-evolving complex

    • Direct observation of structural changes induced by environmental stressors

  • Integrative structural biology approaches:

    • Combination of X-ray crystallography, cryo-EM, NMR, and mass spectrometry

    • Merging data from multiple techniques to generate comprehensive structural models

    • Capturing flexible regions and dynamics not visible in static structures

    • Mapping post-translational modifications and their structural effects

  • Time-resolved serial femtosecond crystallography (TR-SFX):

    • Utilizing X-ray free electron lasers (XFELs) for "diffraction before destruction"

    • Capturing structural snapshots during electron transfer events

    • Millisecond to femtosecond time resolution to follow photochemical reactions

    • Direct observation of water splitting mechanisms

  • Computational advances:

    • Enhanced molecular dynamics simulations of entire PSII complexes

    • Quantum mechanical/molecular mechanical (QM/MM) calculations of electron transfer

    • Machine learning approaches to predict functional effects of mutations

    • Integrative modeling platforms to incorporate diverse experimental constraints

These methodological advances are likely to resolve longstanding questions about psbD function, including: the precise mechanism of water oxidation, proton transfer pathways, the molecular basis of photodamage, and the structural basis for differential sensitivity to herbicides and environmental stressors .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.