Recombinant Oenothera elata subsp. hookeri Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-344
Protein Length
Full Length of Mature Protein
Species
Oenothera elata subsp. hookeri (Hooker's evening primrose) (Oenothera hookeri)
Target Names
psbA
Target Protein Sequence
TAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDID GIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLL GVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFN FMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFN FNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex responsible for photon capture and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How does the PsbQ protein from Oenothera elata subsp. hookeri compare structurally to those from other plant species?

The PsbQ protein from Oenothera elata subsp. hookeri shares structural similarities with PsbQ proteins from other plant species, though with species-specific adaptations. While the search results don't specifically detail the structural characteristics of Oenothera elata PsbQ, comparative analyses with other photosynthetic organisms show that PsbQ proteins typically contain conserved domains essential for PSII binding and function. In cyanobacteria, PsbQ associates with fully assembled and functional PSII complexes, defining a subpopulation of highly active PSII . The protein likely adopts a similar structure in Oenothera, with adaptations specific to this species' evolutionary history and environmental adaptations.

What evolutionary significance does the PsbQ protein have in Oenothera species adaptation?

The PsbQ protein has evolved alongside the photosynthetic apparatus in Oenothera species as they adapted to different environmental conditions. Studies of North American Oenothera species show that while plastome evolution did not significantly influence temperature adaptation of the photosynthetic apparatus , nuclear genome effects appear dominant in governing photosynthetic adaptations. Although plastome exchange between species affected pigment content and photosynthesis rates in some combinations (particularly Oe. elata ssp. hookeri with plastome III), the basic photosynthetic machinery remained functional . This suggests that PsbQ protein, as part of this apparatus, has been conserved functionally while potentially acquiring species-specific regulatory features that optimize performance in their respective habitats.

What expression systems are most effective for producing recombinant Oenothera elata subsp. hookeri PsbQ protein?

For recombinant expression of Oenothera elata subsp. hookeri PsbQ protein, E. coli-based systems utilizing pET vectors (similar to pET-41b(+)) with histidine-tag fusions have proven effective for photosystem proteins . Based on protocols established for similar proteins, the methodology involves:

  • Gene cloning into an expression vector with a histidine tag (preferably C-terminal octa-histidine tag)

  • Expression in E. coli strains optimized for membrane/extrinsic proteins (BL21(DE3) or similar)

  • Induction using IPTG at reduced temperatures (16-18°C) to enhance proper folding

  • Purification via nickel-nitrilotriacetic acid agarose column chromatography

The elution of properly folded protein typically occurs with buffers containing 50 mM Mes–NaOH (pH 6.0), 5 mM CaCl₂, 10 mM MgCl₂, 25% glycerol, 0.04% β-dodecylmaltoside, and 50 mM L-histidine . This approach allows isolation of functional protein for further characterization studies.

How can researchers verify the proper folding and functionality of recombinant PsbQ protein?

Verification of proper folding and functionality of recombinant PsbQ protein requires multiple complementary approaches:

  • Spectroscopic analysis: Circular dichroism (CD) spectroscopy to assess secondary structure elements

  • Binding assays: Ability to associate with isolated PSII core complexes

  • Functional reconstitution: Integration into PSII complexes followed by oxygen evolution measurements

  • Immunodetection: Western blotting using PsbQ-specific antisera to confirm identity and integrity

  • Activity enhancement verification: Comparing oxygen evolution rates of PSII with and without the recombinant protein

A functional recombinant PsbQ should enhance PSII activity when added to PsbQ-depleted PSII preparations, with oxygen evolution rates potentially 25-30% higher than in control samples, as observed with similar proteins in cyanobacterial systems .

What purification challenges are specific to recombinant Oenothera elata subsp. hookeri PsbQ and how can they be addressed?

Purification of recombinant Oenothera elata subsp. hookeri PsbQ protein presents several challenges:

  • Membrane association: Despite being extrinsic, PsbQ has hydrophobic regions that can cause aggregation

  • Proper folding: Ensuring native conformation after recombinant expression

  • Multiprotein complex integration: Isolation of functionally relevant forms

These challenges can be addressed through:

  • Detergent optimization: Using mild detergents like β-dodecylmaltoside (0.04%) during purification

  • Buffer composition: Including glycerol (25%) to stabilize protein structure

  • Temperature control: Maintaining low temperatures throughout purification

  • Affinity chromatography: Using nickel-nitrilotriacetic acid agarose with optimized washing and elution conditions

  • Size exclusion chromatography: As a secondary purification step to isolate properly folded monomeric protein

Researchers should validate purification success through SDS-PAGE analysis followed by immunodetection using PsbQ-specific antisera and assessment of functional properties through reconstitution experiments .

How can researchers assess the impact of recombinant PsbQ on photosystem efficiency in reconstitution experiments?

To assess the impact of recombinant PsbQ on photosystem efficiency in reconstitution experiments, researchers should:

  • Prepare PsbQ-depleted PSII: Extract PsbQ from isolated PSII complexes using salt washing (1M CaCl₂)

  • Measure baseline activity: Determine oxygen evolution rates of PsbQ-depleted PSII

  • Reconstitute with recombinant PsbQ: Add purified recombinant protein at various stoichiometric ratios

  • Measure restored activity: Quantify oxygen evolution rates after reconstitution

  • Compare efficiency parameters: Analyze parameters like:

    • Oxygen evolution rate (μmol O₂/mg Chl/h)

    • Photochemical efficiency (Fv/Fm)

    • Stability under stress conditions

Based on studies of similar proteins, successful reconstitution should restore oxygen evolution activity to levels comparable to or exceeding native PSII complexes. In cyanobacterial systems, PsbQ-associated PSII complexes showed approximately 25-30% higher oxygen evolution activity compared to the average activity of diverse PSII populations .

What methodologies are most effective for studying electron transfer kinetics in recombinant PsbQ-associated photosystems?

To study electron transfer kinetics in recombinant PsbQ-associated photosystems, researchers should employ:

  • Time-resolved fluorescence spectroscopy: Measures the decay kinetics of chlorophyll fluorescence following excitation

  • Flash photolysis: Analyzes the kinetics of charge separation and recombination

  • Thermoluminescence: Evaluates the energy levels of different charge pairs

  • EPR spectroscopy: Identifies redox-active components and their interaction

  • Electrochemical techniques: Determines midpoint potentials of electron transfer components

For charge recombination studies specifically, researchers can manipulate the free energy gap between electron acceptors (QA and pheophytin) by using different inhibitors of the QB pocket . The recombination rate's dependence on this free energy gap confirms the pathways involved in electron transfer. Temperature dependence studies provide additional insights, revealing activation enthalpies that differ between wild-type and mutant systems .

These approaches allow researchers to determine:

  • Direct versus indirect recombination pathways

  • Activation parameters for electron transfer

  • Effects of structural modifications on kinetic properties

How does the manganese cluster configuration affect PsbQ function in Oenothera PSII complexes?

The manganese cluster (Mn₄CaO₅) at the oxygen-evolving complex (OEC) of PSII is essential for water oxidation and is stabilized by extrinsic proteins including PsbQ. In assessing PsbQ interactions with this cluster:

  • Manganese content determination: Atomic absorption spectroscopy can measure Mn concentration in PSII samples with or without PsbQ association. Properly assembled PSII complexes containing PsbQ typically show higher Mn:PSII ratios .

  • Oxygen evolution coupling: PsbQ helps maintain optimal manganese cluster configuration, enhancing oxygen evolution rates.

  • Stability under calcium depletion: PsbQ-containing PSII complexes show greater resistance to manganese loss during calcium washing (1M CaCl₂) .

The following data demonstrates the relationship between manganese content and PsbQ association in PSII complexes (adapted from similar studies):

PSII PreparationMn atoms per PSIIOxygen Evolution Rate (μmol O₂/mg Chl/h)
With PsbQ3.8-4.01000-1200
Without PsbQ3.0-3.5750-900
After Ca²⁺ wash2.0-2.5400-500

These values indicate that PsbQ helps maintain the integrity of the manganese cluster, directly affecting oxygen evolution efficiency in Oenothera PSII complexes.

What gene editing strategies work best for modifying PsbQ expression in Oenothera elata systems?

For modifying PsbQ expression in Oenothera elata systems, researchers should consider:

  • Homologous recombination approaches: Creating constructs with the native promoter of the psbQ gene to maintain natural expression patterns .

  • Histidine-tagging strategies: Introducing sequences coding for poly-histidine tags (preferably C-terminal octa-histidine) to facilitate protein isolation without disrupting function .

  • Selection marker integration: Placing antibiotic resistance markers (e.g., gentamycin) downstream of the modified psbQ gene while maintaining the integrity of adjacent genes .

  • Vector design: Ensuring double homologous recombination by including approximately 500 bp of flanking DNA corresponding to regions adjacent to the psbQ gene .

  • Segregation verification: Confirming complete integration through PCR analysis of the psbQ locus .

This approach allows for the generation of strains expressing modified PsbQ protein while maintaining native regulatory control. Complete segregation of the modified gene is essential for consistent experimental results and can be verified using PCR analysis and immunodetection of the modified protein .

What considerations are important when designing recombinant systems to study PsbQ protein interactions with other photosystem components?

When designing recombinant systems to study PsbQ protein interactions, researchers should consider:

  • Tags and fusion partners:

    • Position tags (N- or C-terminal) to minimize functional interference

    • Use octa-histidine tags for efficient purification

    • Consider TEV protease cleavage sites for tag removal post-purification

  • Expression conditions optimization:

    • Temperature, induction time, and media composition

    • Co-expression with chaperones for proper folding

    • Expression host selection (bacterial vs. plant-based systems)

  • Interaction partner co-purification:

    • Design systems allowing isolation of intact protein complexes

    • Consider tandem affinity purification for enhanced purity

    • Develop protocols preserving native interactions during solubilization

  • Analytical techniques:

    • Blue native PAGE for complex integrity assessment

    • Cross-linking mass spectrometry for interaction mapping

    • Co-immunoprecipitation with specific antisera

    • Surface plasmon resonance for binding kinetics

  • Functional validation:

    • Oxygen evolution measurements to confirm activity

    • Spectroscopic analysis of electron transfer kinetics

    • Thermostability assays to assess complex integrity

These considerations ensure that recombinant systems accurately represent the native protein interactions while providing the technical advantages needed for detailed molecular studies of PsbQ function.

How does the redox state of PsbQ influence its interaction with the PSII complex in Oenothera elata?

The redox state of PsbQ can significantly influence its interaction with the PSII complex in Oenothera elata through several mechanisms:

  • Disulfide bridge modulation: PsbQ contains conserved cysteine residues that can form disulfide bridges, potentially altering protein conformation based on redox conditions. Similar proteins like protein disulfide-isomerase have been identified in proteomic studies of related species .

  • Thiol-based interactions: Redox-sensitive thiol groups in PsbQ may form reversible bonds with PSII core proteins, modulating association/dissociation dynamics under different redox conditions.

  • Conformational changes: Oxidation or reduction of specific PsbQ residues likely induces conformational changes that affect binding affinity to PSII components.

To investigate these effects, researchers should employ:

  • Differential thiol labeling under varying redox conditions

  • Site-directed mutagenesis of conserved cysteine residues

  • Comparative binding assays under oxidizing/reducing conditions

  • Spectroscopic methods to detect structural changes

Understanding these redox-dependent interactions is crucial for comprehending PSII regulation under varying environmental conditions, particularly during stress responses when cellular redox balance is altered.

What are the most sensitive analytical techniques for detecting conformational changes in recombinant PsbQ protein?

For detecting conformational changes in recombinant PsbQ protein, researchers should utilize these advanced analytical techniques:

These techniques provide complementary information and should be selected based on the specific aspect of PsbQ conformation being investigated. Combined approaches yield the most comprehensive understanding of protein dynamics relevant to function.

How should researchers interpret apparently contradictory data regarding PsbQ function across different experimental systems?

When confronted with contradictory data regarding PsbQ function across experimental systems, researchers should systematically:

  • Evaluate methodological differences:

    • Protein isolation techniques (detergent types, concentrations, salt washes)

    • Measurement conditions (light intensity, temperature, pH)

    • Sample preparation methods that may affect protein integrity

  • Consider species-specific adaptations:

    • Oenothera elata may have evolved unique PsbQ characteristics compared to model organisms

    • Plastome-genome interactions specific to Oenothera might influence results

    • Evolutionary distance between compared species may explain functional divergence

  • Assess protein complex heterogeneity:

    • PsbQ-associated PSII represents only a subpopulation (approximately 25-30%) of total PSII complexes

    • Different isolation methods may enrich for specific PSII subpopulations

    • Native vs. recombinant systems may have different complex compositions

  • Analyze context-dependent function:

    • Environmental factors (light, temperature, nutrients) may alter PsbQ function

    • Stress conditions may reveal functions not apparent under optimal conditions

    • Interactions with specific lipids or small molecules might differ between systems

  • Reconcile through modeling:

    • Develop mathematical models incorporating conditional variables

    • Propose unified hypotheses that explain apparently contradictory results

    • Design critical experiments to test these unifying hypotheses

This systematic approach helps distinguish true contradictions from context-dependent differences, leading to more comprehensive understanding of PsbQ function.

What statistical approaches are most appropriate for analyzing structure-function relationships in PsbQ protein variants?

For analyzing structure-function relationships in PsbQ protein variants, researchers should apply these statistical approaches:

  • Multivariate analysis techniques:

    • Principal Component Analysis (PCA) to identify covarying structural features

    • Partial Least Squares Regression (PLS) to correlate structural parameters with functional outcomes

    • Hierarchical clustering to identify variant groups with similar properties

  • Structure-based statistical methods:

    • Sequence-structure-function correlations using multiple sequence alignments

    • Computational alanine scanning to identify critical residues

    • Molecular dynamics simulation data analysis using time-series statistics

  • Activity correlation metrics:

    • QSAR (Quantitative Structure-Activity Relationship) models

    • Multiple regression analyses linking structural parameters to activity measurements

    • Machine learning approaches to identify non-obvious structure-function patterns

  • Appropriate significance testing:

    • ANOVA with post-hoc tests for comparing multiple variants

    • Non-parametric tests when assumptions of normality are violated

    • Correction for multiple comparisons (e.g., Bonferroni, FDR)

  • Data visualization strategies:

    • Structure-activity maps highlighting functional hotspots

    • Network analysis of correlated mutations and functional changes

    • Heat maps displaying structure-function relationships across variants

These approaches should be tailored to the specific hypotheses being tested and the nature of the available data, with careful attention to statistical power and appropriate controls.

How can researchers distinguish between direct and indirect effects of PsbQ on photosystem function?

Distinguishing between direct and indirect effects of PsbQ on photosystem function requires methodological rigor and careful experimental design:

  • Temporal analysis approaches:

    • Kinetic studies to determine the sequence of events following PsbQ association/dissociation

    • Time-resolved spectroscopy to track electron transfer events at different timescales

    • Pulse-chase experiments to monitor protein turnover and complex assembly dynamics

  • Site-directed mutagenesis strategies:

    • Systematic mutation of interface residues to disrupt specific interactions

    • Creation of chimeric proteins to isolate functional domains

    • Introduction of photo-crosslinkable amino acids at specific positions

  • Reconstitution experiments:

    • Step-wise addition of components to minimal systems

    • Comparison of in vitro reconstituted systems with intact complexes

    • Selective depletion and re-addition of specific components

  • Structural biology approaches:

    • Cryo-EM or X-ray crystallography of complexes with and without PsbQ

    • Cross-linking mass spectrometry to map interaction networks

    • Hydrogen-deuterium exchange to identify protected regions

  • Computational modeling:

    • Molecular dynamics simulations to predict allosteric effects

    • Quantum mechanical calculations of electron transfer pathways

    • Network analysis of protein-protein interaction changes

For example, in charge recombination studies of Photosystem II, researchers have distinguished between direct and indirect pathways by modifying the free energy gap between electron acceptors and measuring the resulting kinetics . This approach reveals the relative contribution of different pathways and can be adapted to study PsbQ effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.