Recombinant Oenothera glazioviana Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
34-318
Protein Length
Full Length of Mature Protein
Species
Oenothera glazioviana (Large-flowered evening primrose) (Oenothera erythrosepala)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDRQVKQV LANGKKGGLNVGAVLILPEGFELAPPARISPEMKERIGNPSFQSYRPTKKNILVIGPVPG QKYSEITFPILSPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGIVS KIIRKEKGGYEITITDASDGRQVVDIIPSGPELLVSEGESIKLDQPLTSNPNVGGFGQGD AEVVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f (petA) from Oenothera glazioviana and what is its significance in plant biochemistry?

Apocytochrome f, encoded by the petA gene, is a crucial component of the photosynthetic electron transport chain in Oenothera glazioviana (Large-flowered evening primrose, also known as Oenothera erythrosepala). The mature protein spans amino acids 34-318 of the full sequence and plays an essential role in electron transfer processes within the chloroplast . The protein's significance lies in its central position in the cytochrome b6f complex, which mediates electron transfer between photosystems II and I during photosynthesis. This makes it a valuable target for studies on photosynthetic efficiency, plant metabolism, and evolutionary adaptations in energy conversion processes. The conservation of this protein across multiple plant species (with >80% sequence homology compared to spinach, wheat, and pea) underscores its fundamental importance in plant biochemistry and photosynthetic function .

How is the recombinant Oenothera glazioviana Apocytochrome f (petA) protein typically expressed and purified for research applications?

The recombinant Apocytochrome f (petA) protein from Oenothera glazioviana is typically expressed in E. coli expression systems, which allow for high-yield production of the functional protein . The full-length mature protein (amino acids 34-318) is commonly produced with an N-terminal His-tag to facilitate purification through affinity chromatography techniques .

The expression protocol generally involves:

  • Transformation of E. coli with a plasmid containing the codon-optimized petA gene sequence

  • Culture growth under controlled conditions with appropriate antibiotic selection

  • Induction of protein expression at optimal cell density

  • Cell harvesting and lysis under conditions that preserve protein integrity

  • Affinity purification using His-tag binding columns

  • Quality assessment via SDS-PAGE to confirm purity (typically >90%)

The purified protein is often supplied in a lyophilized form for stability, requiring reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL before experimental use. For optimal stability, addition of 5-50% glycerol and storage at -20°C/-80°C is recommended to maintain protein integrity for extended periods .

What are the structural characteristics of Oenothera glazioviana Apocytochrome f and how do they compare to homologs from other plant species?

Oenothera glazioviana Apocytochrome f exhibits specific structural characteristics that are highly conserved across plant species. The mature protein consists of 285 amino acids with an additional 33-residue N-terminal signal sequence that directs the protein to the chloroplast membrane . This pre-sequence is notably 2 residues shorter than those identified in spinach, wheat, and pea homologs .

The amino acid sequence (YPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDRQVKQVLANGKKGGLNVGAVLILPEGFELAPPARISPEMKERIGNPSFQSYRPTKKNILVIGPVPGQKYSEITFPILSPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGIVSKIIRKEKGGYEITITDASDGRQVVDIIPSGPELLVSEGESIKLDQPLTSNPNVGGFGQGDAEVVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF) reveals key functional domains including :

  • Heme-binding motifs with characteristic cysteine residues

  • Hydrophobic membrane-anchoring regions

  • Electron transfer domains essential for photosynthetic function

Comparative analysis shows that Oenothera glazioviana Apocytochrome f shares over 80% sequence conservation with homologs from other plant species, with the highest conservation observed in functional domains responsible for electron transfer and heme coordination . This high degree of conservation underscores the evolutionary importance of this protein in maintaining efficient photosynthetic machinery across diverse plant lineages.

How should researchers optimize storage and handling of recombinant Oenothera glazioviana Apocytochrome f to maintain structural integrity for experimental applications?

Proper storage and handling of recombinant Oenothera glazioviana Apocytochrome f is critical for maintaining its structural and functional integrity. Based on established protocols, researchers should follow these guidelines:

Storage Recommendations:

  • Upon receipt, store the lyophilized protein at -20°C to -80°C for long-term stability

  • After reconstitution, add glycerol to a final concentration of 5-50% (with 50% being optimal) to prevent freeze-thaw damage

  • Aliquot the reconstituted protein into single-use volumes to avoid repeated freeze-thaw cycles, which can significantly decrease protein functionality

  • For working solutions needed within one week, store aliquots at 4°C to minimize degradation while maintaining accessibility

Handling Protocol:

  • Before opening, briefly centrifuge vials to ensure all material is at the bottom

  • Reconstitute using deionized sterile water to achieve concentrations between 0.1-1.0 mg/mL

  • Use appropriate buffer systems for experimental applications (Tris/PBS-based buffers with 6% trehalose at pH 8.0 are compatible with this protein)

  • When conducting experiments requiring temperature changes, gradually equilibrate the protein to minimize structural stress

These handling procedures are essential for ensuring experimental reproducibility and maintaining the functional characteristics of the recombinant protein throughout research applications.

What are the most effective immunological detection methods for Oenothera glazioviana Apocytochrome f in experimental systems?

For optimal immunological detection of Oenothera glazioviana Apocytochrome f in experimental systems, researchers can employ several complementary approaches that balance sensitivity with specificity:

Western Blot Analysis:

  • Separate protein samples using SDS-PAGE (10-12% gels are typically effective)

  • Transfer to nitrocellulose or PVDF membranes using standard protocols

  • Block with 5% non-fat milk or BSA in TBST

  • Primary detection options:

    • Anti-His antibodies when working with His-tagged recombinant protein

    • Custom anti-Apocytochrome f antibodies raised against conserved epitopes

    • Cross-reactive antibodies developed against homologous proteins from other species

  • Visualization using HRP-conjugated secondary antibodies with chemiluminescent detection

ELISA-Based Detection:
ELISA methods offer high sensitivity for quantitative detection of Apocytochrome f in complex samples :

  • Coat plates with capture antibody specific to Apocytochrome f or the affinity tag

  • Apply samples in a concentration gradient alongside recombinant protein standards

  • Detect using biotinylated detection antibodies with streptavidin-HRP conjugates

  • Develop with appropriate substrate and measure absorbance at relevant wavelengths

Immunocytochemistry/Immunohistochemistry:
For localization studies in plant tissues:

  • Fix samples appropriately (4% paraformaldehyde typically works well)

  • Permeabilize cell walls and membranes without destroying antigenicity

  • Block with species-appropriate normal serum

  • Apply primary antibodies against Apocytochrome f (dilution optimization required)

  • Detect with fluorophore-conjugated secondary antibodies

  • Counterstain chloroplasts with appropriate markers to confirm localization

The selection of detection method should be guided by experimental objectives, with considerations for sensitivity requirements, sample type, and whether qualitative or quantitative data is needed.

What optimization strategies can improve the expression yield of recombinant Oenothera glazioviana Apocytochrome f in E. coli systems?

Maximizing expression yield of recombinant Oenothera glazioviana Apocytochrome f in E. coli requires systematic optimization of multiple parameters:

Strain Selection:

  • BL21(DE3) derivatives are often preferred due to reduced protease activity

  • Rosetta or CodonPlus strains can enhance expression by supplying rare codons found in plant genes but uncommon in E. coli

  • C41/C43 strains may improve expression of membrane-associated proteins like Apocytochrome f

Vector Optimization:

  • Select vectors with strong, inducible promoters (T7, tac)

  • Incorporate optimal ribosome binding sites for efficient translation initiation

  • Consider using fusion partners that enhance solubility (SUMO, thioredoxin, MBP)

  • Include appropriate secretion signals if targeting to periplasm is desired

Expression Conditions Optimization:

ParameterStandard ConditionsOptimization RangeNotes
Temperature37°C16-30°CLower temperatures often increase soluble protein yield
Induction OD6000.6-0.80.4-2.0Later induction can improve yields for some constructs
IPTG Concentration1.0 mM0.01-1.0 mMLower concentrations may reduce inclusion body formation
Post-induction Time4 hours4-24 hoursExtended times at lower temperatures often beneficial
MediaLBTB, 2xYT, AutoinductionRicher media can significantly increase biomass

Solubility Enhancement:

  • Co-express molecular chaperones (GroEL/ES, DnaK/J) to aid proper folding

  • Add specific cofactors required for protein stability to the culture medium

  • Optimize lysis conditions using mild detergents appropriate for membrane-associated proteins

  • Consider periplasmic expression strategies to facilitate disulfide bond formation

Purification Strategy Refinement:

  • Use multi-step purification combining affinity chromatography with size exclusion and/or ion exchange methods

  • Optimize buffer composition to maintain protein stability throughout purification

  • Minimize exposure to harsh elution conditions that might compromise protein integrity

By systematically testing these variables and combinations thereof, researchers can develop an optimized protocol that significantly increases the yield of functional recombinant Oenothera glazioviana Apocytochrome f protein.

How can researchers effectively study the electron transfer function of recombinant Oenothera glazioviana Apocytochrome f in reconstituted systems?

Studying electron transfer functions of recombinant Oenothera glazioviana Apocytochrome f requires careful experimental design to create appropriate in vitro systems that mimic the protein's native environment:

Liposome Reconstitution Approach:

  • Prepare liposomes with lipid compositions resembling thylakoid membranes (phosphatidylcholine, phosphatidylglycerol, and monogalactosyldiacylglycerol)

  • Incorporate purified recombinant Apocytochrome f into preformed liposomes using gentle detergent-mediated methods

  • Verify orientation and incorporation efficiency using protease protection assays and Western blotting

  • Add appropriate electron donors and acceptors to the reconstituted system

  • Monitor electron transfer kinetics using spectroscopic methods

Spectroscopic Analysis Methods:

  • UV-Visible spectroscopy to monitor redox state changes (absorption peaks at ~553 nm in reduced state)

  • Stopped-flow spectroscopy for rapid kinetic measurements of electron transfer reactions

  • Circular dichroism to confirm proper protein folding and structural integrity

  • Fluorescence spectroscopy to monitor conformational changes during electron transfer

Electrochemical Characterization:

  • Cyclic voltammetry to determine redox potentials of the reconstituted Apocytochrome f

  • Protein film voltammetry on modified electrodes to measure direct electron transfer properties

  • Potentiometric titrations to establish the midpoint potential under varying conditions

Functional Validation Experiments:

  • Complement Apocytochrome f-deficient mutant systems with the recombinant protein

  • Measure restoration of electron transport rates compared to positive controls

  • Conduct site-directed mutagenesis of key residues (identified from the sequence analysis) to correlate structure with function

  • Compare kinetic parameters with native protein to verify functional equivalence

These methodologies provide comprehensive approaches to characterize the electron transfer capabilities of recombinant Oenothera glazioviana Apocytochrome f while offering insights into its structural and functional properties in a controlled experimental setting.

What considerations are important when designing experiments to study interactions between Apocytochrome f and other components of the photosynthetic electron transport chain?

When investigating interactions between Oenothera glazioviana Apocytochrome f and other components of the photosynthetic electron transport chain, researchers must consider several critical experimental design factors:

Protein Partner Selection and Preparation:

  • Identify physiologically relevant interaction partners (plastocyanin, cytochrome b6, Rieske iron-sulfur protein)

  • Express and purify interaction partners with appropriate tags that won't interfere with binding interfaces

  • Verify proper folding of all proteins using circular dichroism or other structural techniques

  • Ensure proper cofactor incorporation (heme groups, copper centers, iron-sulfur clusters)

Interaction Analysis Methods:

TechniqueAdvantagesLimitationsData Output
Surface Plasmon ResonanceReal-time kinetics, label-freeRequires surface immobilizationAssociation/dissociation rates, KD values
Isothermal Titration CalorimetryDirect measurement, thermodynamic parametersHigh protein consumptionBinding constants, enthalpic/entropic contributions
Microscale ThermophoresisLow sample consumption, native conditionsRequires fluorescent labelingBinding affinity (KD)
Co-immunoprecipitationCan detect complexes from native systemsAntibody specificity criticalQualitative complex formation
FRET/BRETCan detect interactions in live systemsRequires fluorescent labelingProximity and dynamics information

Environmental Parameter Considerations:

  • pH optimization reflecting the thylakoid lumen environment (pH 5.5-6.5 during photosynthesis)

  • Ionic strength adjustments to mimic physiological conditions

  • Temperature control to reflect native conditions for the evening primrose

  • Redox state manipulation to examine electron transfer-dependent interactions

Control Experiments:

  • Use non-interacting protein pairs as negative controls

  • Include known interaction partners as positive controls

  • Perform competition assays with unlabeled proteins to verify specificity

  • Test interaction under varying redox conditions to confirm physiologically relevant binding

Functional Validation:

  • Reconstitute minimal systems with defined components to measure electron transfer rates

  • Use site-directed mutagenesis of key interface residues to confirm interaction mechanisms

  • Correlate binding properties with functional electron transfer parameters

  • Compare results with established data from model plant systems

By carefully addressing these considerations, researchers can develop robust experimental systems that yield meaningful insights into the protein-protein interactions crucial for Apocytochrome f function within the photosynthetic electron transport chain.

How does the genetic variation in Oenothera glazioviana petA gene affect the functional properties of the Apocytochrome f protein?

The relationship between genetic variation in the Oenothera glazioviana petA gene and functional properties of Apocytochrome f represents an important area of investigation with implications for understanding photosynthetic adaptation and evolution:

Genetic Context of Oenothera glazioviana:
Oenothera glazioviana possesses several genetic characteristics that make it particularly valuable for studying gene-function relationships :

  • It is a PTH (permanent translocation heterozygote) species forming a ring of 12 chromosomes and 1 bivalent in meiosis

  • It maintains plastome II or III with an AB genome composition

  • It originated through hybridization between cultivated or naturalized species in Europe

  • Its widespread distribution across diverse habitats suggests adaptive capacity potentially linked to photosynthetic protein variants

Approaches to Studying Sequence-Function Relationships:

  • Population genomics: Sample petA sequences from diverse Oenothera glazioviana populations to identify naturally occurring variants

  • Site-directed mutagenesis: Generate specific mutations based on observed natural variations

  • Heterologous expression: Express variants in model systems for comparative functional analysis

  • Biophysical characterization: Compare electron transfer rates, redox potentials, and protein stability among variants

Functional Implications of Sequence Variations:
Research indicates several potential consequences of petA gene variations:

  • Alterations in heme-binding motifs can affect redox potentials and electron transfer efficiency

  • Changes in membrane-spanning domains may influence protein orientation and stability

  • Modifications to interaction surfaces can alter binding affinities with partner proteins

  • Variations affecting post-translational modifications might impact protein turnover or regulation

Experimental Validation Methods:

  • Electron transfer kinetics measurements using laser flash photolysis

  • Thermal stability assays comparing protein unfolding profiles

  • Structural studies using spectroscopic methods to detect conformational differences

  • In vivo complementation assays to assess functional impacts

What role does Apocytochrome f play in the assembly and stability of the cytochrome b6f complex, and how can recombinant proteins be used to study these processes?

The role of Apocytochrome f in cytochrome b6f complex assembly and stability represents a sophisticated area of research where recombinant proteins offer unique investigative advantages:

Assembly Process and Critical Interactions:
Apocytochrome f serves as a pivotal component in the cytochrome b6f complex assembly pathway through:

  • Initial integration into the thylakoid membrane via the chloroplast signal peptide (33 residues in Oenothera glazioviana)

  • Covalent attachment of the heme group to form mature cytochrome f

  • Sequential recruitment of additional subunits through specific protein-protein interactions

  • Formation of the functional dimeric complex required for efficient electron transport

Recombinant Protein-Based Experimental Approaches:

  • In vitro Assembly Systems:

    • Reconstitute minimal complexes using purified recombinant components

    • Monitor assembly intermediates via native PAGE and immunodetection

    • Use fluorescently labeled components to track assembly kinetics in real-time

  • Mutational Analysis:

    • Generate structure-guided mutations in key domains of recombinant Apocytochrome f

    • Assess effects on complex formation and stability

    • Identify critical residues for protein-protein interactions and complex integrity

  • Crosslinking and Interaction Mapping:

    • Apply chemical crosslinking combined with mass spectrometry (XL-MS)

    • Identify interaction interfaces between Apocytochrome f and other complex components

    • Validate findings through targeted mutagenesis of identified contact residues

  • Stability Assessment Methods:

    • Thermal shift assays comparing stability of complexes formed with wild-type versus mutant Apocytochrome f

    • Limited proteolysis to identify protected regions following complex formation

    • Analytical ultracentrifugation to characterize complex integrity and oligomeric state

Applications in Comparative Studies:
Recombinant Oenothera glazioviana Apocytochrome f allows for direct comparison with homologs from other plant species :

  • Assess conservation of assembly mechanisms across evolutionary distance

  • Identify species-specific adaptations in complex formation

  • Correlate sequence variations with differences in complex stability

  • Develop models for the evolution of multi-protein photosynthetic complexes

Technological Innovations:

  • Develop in vitro translation systems coupled with thylakoid membranes for real-time assembly studies

  • Create hybrid complexes containing components from different species to assess compatibility

  • Apply cryo-electron microscopy to visualize assembly intermediates at high resolution

This research area not only advances understanding of fundamental bioenergetic complexes but also provides insights applicable to the engineering of enhanced photosynthetic efficiency in crop plants.

How can structural comparisons between Oenothera glazioviana Apocytochrome f and homologs from other plant species inform our understanding of photosynthetic evolution?

Structural comparisons between Oenothera glazioviana Apocytochrome f and homologs from other plant species provide critical insights into photosynthetic evolution, adaptation, and functional conservation:

Sequence-Structure-Function Relationships:
The high degree of sequence conservation (>80%) observed between Oenothera glazioviana Apocytochrome f and homologs from spinach, wheat, and pea points to strong evolutionary constraints on this protein. Detailed structural analysis reveals:

  • Conserved Functional Domains:

    • Heme-binding motifs maintaining critical electron transfer capabilities

    • Membrane-anchoring regions with consistent hydrophobicity profiles

    • Interaction surfaces for partner proteins like plastocyanin and cytochrome b6

  • Variable Regions:

    • N-terminal signal sequence (33 residues in Oenothera glazioviana, 35 in spinach, wheat, and pea)

    • Surface-exposed loops potentially involved in species-specific interactions

    • Regions potentially related to environmental adaptations or regulatory mechanisms

Methodological Approaches to Comparative Analysis:

  • Homology Modeling and Structural Alignment:

    • Generate structural models based on crystallographic data from model species

    • Superimpose structures to identify conserved structural elements versus variable regions

    • Calculate root-mean-square deviation (RMSD) values to quantify structural divergence

  • Molecular Dynamics Simulations:

    • Simulate protein behavior in membrane environments

    • Compare dynamic properties between homologs from different species

    • Identify species-specific differences in conformational flexibility

  • Phylogenetic Analysis Coupled with Structural Mapping:

    • Construct phylogenetic trees based on petA sequences from diverse plant species

    • Map sequence variations onto structural models

    • Correlate evolutionary distance with structural divergence

Evolutionary Insights from Oenothera glazioviana Apocytochrome f:
Oenothera glazioviana offers a unique evolutionary perspective because:

  • It originated through hybridization between cultivated or naturalized species in Europe

  • It has an unusual chromosomal structure with a ring of 12 chromosomes and 1 bivalent in meiosis

  • Its plastome (II or III) and AB genome composition create distinct evolutionary pressures

  • Its widespread distribution suggests adaptive capacity potentially reflected in photosynthetic proteins

Applications to Evolutionary Biology:

  • Identify signatures of selection in specific domains of Apocytochrome f

  • Correlate structural variations with habitat-specific adaptations

  • Develop models for co-evolution of interacting photosynthetic components

  • Trace the evolutionary history of electron transport chain components across plant lineages

These comparative approaches not only enhance our understanding of photosynthetic evolution but also provide insights into adaptations that might be leveraged for engineering improved photosynthetic efficiency in crop plants facing changing environmental conditions.

What experimental approaches can reveal the effects of post-translational modifications on Oenothera glazioviana Apocytochrome f function?

Investigating post-translational modifications (PTMs) of Oenothera glazioviana Apocytochrome f requires sophisticated experimental approaches that combine proteomic, biochemical, and functional analyses:

Identification of Potential PTMs:

  • Mass Spectrometry-Based Proteomic Analysis:

    • Sample preparation from isolated thylakoid membranes or purified cytochrome b6f complexes

    • Enzymatic digestion optimized for membrane proteins

    • LC-MS/MS analysis with data-dependent acquisition

    • Database searching with variable modifications including:

      • Phosphorylation (Ser, Thr, Tyr)

      • Acetylation (Lys, N-terminus)

      • Methylation (Lys, Arg)

      • Oxidation (Met, Cys)

      • Heme attachment (Cys)

    • PTM site localization and abundance quantification

  • Targeted PTM Antibody-Based Detection:

    • Western blotting with PTM-specific antibodies (anti-phospho, anti-acetyl)

    • Immunoprecipitation to enrich modified forms

    • Validation of MS-identified modifications

Functional Characterization of PTMs:

  • Site-Directed Mutagenesis Approach:

    • Generate recombinant proteins with mutations at identified PTM sites:

      • Phosphomimetic mutations (Ser/Thr → Asp/Glu)

      • Phosphoablative mutations (Ser/Thr → Ala)

      • Acetylation mimics (Lys → Gln)

      • Non-modifiable variants (based on identified PTM sites)

    • Express and purify mutant proteins for functional comparison

  • In Vitro Modification Systems:

    • Treat purified recombinant Apocytochrome f with:

      • Kinases and ATP for phosphorylation

      • Acetyltransferases and acetyl-CoA for acetylation

      • Methyltransferases and SAM for methylation

    • Verify modification using mass spectrometry

    • Compare functional properties before and after modification

Functional Assessment Methods:

  • Electron Transfer Kinetics:

    • Laser flash photolysis to measure electron transfer rates

    • Stopped-flow spectroscopy to monitor redox transitions

    • Comparison between modified and unmodified forms

  • Protein-Protein Interaction Analysis:

    • Surface plasmon resonance with interaction partners

    • Pull-down assays with modified versus unmodified protein

    • Crosslinking efficiency comparisons

  • Structural Impact Assessment:

    • Circular dichroism to detect secondary structure changes

    • Limited proteolysis susceptibility patterns

    • Thermal stability measurements

Physiological Relevance Studies:

  • Environmental Response Correlation:

    • Analyze PTM patterns under varying light conditions

    • Compare PTM profiles during different developmental stages

    • Assess modifications under stress conditions (heat, drought, high light)

  • Comparative Analysis Across Species:

    • Compare PTM sites between Oenothera glazioviana and model plants

    • Identify conserved modification patterns suggesting fundamental regulatory mechanisms

This comprehensive approach allows researchers to not only identify PTMs on Oenothera glazioviana Apocytochrome f but also to understand their functional significance in regulating photosynthetic electron transport under varying physiological conditions.

How can researchers use recombinant Oenothera glazioviana Apocytochrome f to investigate the impact of environmental stress on photosynthetic electron transport?

Recombinant Oenothera glazioviana Apocytochrome f provides a valuable tool for investigating environmental stress effects on photosynthetic electron transport through systematic experimental approaches:

In Vitro Stress Simulation Systems:

  • Temperature Stress Models:

    • Expose purified recombinant Apocytochrome f to controlled temperature gradients

    • Monitor structural stability and functional changes using spectroscopic methods

    • Compare thermal sensitivity to homologs from plants adapted to different thermal environments

    • Identify specific domains or residues conferring thermal resistance/sensitivity

  • Oxidative Stress Assessment:

    • Treat recombinant protein with defined concentrations of reactive oxygen species

    • Analyze oxidative modifications using mass spectrometry

    • Measure impact on electron transfer efficiency

    • Test protective mechanisms using antioxidant molecules

  • pH Fluctuation Effects:

    • Characterize protein function across pH gradients mimicking stress-induced lumen acidification

    • Identify critical pH thresholds affecting protein stability and function

    • Compare pH sensitivity between species adapted to different environments

Experimental Design for Stress Response Studies:

Stress FactorMeasurement ParametersAnalysis MethodsControl Conditions
TemperatureElectron transfer rate, protein unfolding, aggregationCD spectroscopy, light scattering, activity assaysRoom temperature, native-like buffer
Oxidative stressROS-induced modifications, functional impairmentMS/MS detection of oxidized residues, electron transfer kineticsAnaerobic conditions
pH stressConformational changes, activity alterationsIntrinsic fluorescence, activity measurementOptimal pH buffer systems
Metal ion stressBinding interactions, conformational impactITC, fluorescence quenching, CD spectroscopyMetal-free conditions

Integration with Plant Systems:

  • Complementation Studies:

    • Transform Apocytochrome f-deficient mutants with stress-modified variants

    • Assess restoration of photosynthetic function under controlled stress conditions

    • Compare performance with wild-type protein

  • Correlation with Native Systems:

    • Extract cytochrome b6f complexes from stress-exposed Oenothera glazioviana plants

    • Compare modifications and functional alterations with in vitro stress-treated recombinant protein

    • Validate in vitro findings in the physiological context

Biotechnological Applications:

  • Stress-Resistant Variant Development:

    • Apply directed evolution approaches to generate stress-tolerant Apocytochrome f variants

    • Screen libraries for improved performance under specific stress conditions

    • Characterize molecular basis of enhanced stress resistance

  • Predictive Modeling:

    • Develop structure-based models predicting stress vulnerability

    • Identify critical residues determining stress sensitivity

    • Guide rational design of stress-resistant photosynthetic components

This research direction not only advances fundamental understanding of photosynthetic adaptation mechanisms but also offers potential applications in developing crops with enhanced stress tolerance in changing climate conditions.

What insights can comparative analysis of Oenothera glazioviana Apocytochrome f provide about the co-evolution of nuclear and chloroplast genomes in the Oenothera genus?

The comparative analysis of Oenothera glazioviana Apocytochrome f offers unique insights into nuclear-chloroplast genome co-evolution, particularly given the unusual genetic system of the Oenothera genus:

Genetic Context of Oenothera glazioviana:
Oenothera glazioviana possesses several distinctive genetic features highly relevant to co-evolutionary studies :

  • It originated through hybridization between cultivated or naturalized species in Europe

  • It functions as a PTH (permanent translocation heterozygote) species forming a ring of 12 chromosomes and 1 bivalent in meiosis

  • It maintains plastome II or III with an AB genome composition

  • It exhibits approximately 50% pollen fertility and seed abortion rates, suggesting ongoing genetic compatibility challenges

Research Approaches for Co-evolutionary Analysis:

  • Comparative Genomic Analysis:

    • Sequence petA and interacting nuclear-encoded genes across Oenothera species

    • Identify correlated substitution patterns suggesting co-evolution

    • Map genome-plastome compatibility patterns across the genus

  • Functional Compatibility Testing:

    • Express recombinant Apocytochrome f variants alongside nuclear-encoded interaction partners

    • Assess binding affinity and electron transfer efficiency between components

    • Identify combinations showing enhanced or reduced functionality

  • Hybridization Studies:

    • Create artificial nuclear-plastome combinations using cybrid techniques

    • Evaluate photosynthetic efficiency and cytochrome b6f complex assembly

    • Correlate functional outcomes with sequence variations in key components

Molecular Evidence of Co-evolution:
Several features of Oenothera glazioviana Apocytochrome f suggest co-evolutionary processes:

  • The pre-sequence of Apocytochrome f (33 residues) differs from those of other species (35 residues) , potentially reflecting adaptation to species-specific import machinery

  • Conservation of core functional domains alongside species-specific variations in peripheral regions suggests selective pressures maintaining critical interactions

  • The location of the petA gene at the border of a 45 kbp inversion distinguishing spinach and Oenothera plastid chromosomes highlights structural genome evolution alongside sequence evolution

Implications for Evolutionary Biology:

  • Cytonuclear Co-adaptation Models:

    • Development of frameworks explaining the maintenance of compatibility despite rapid evolution

    • Identification of compensatory mutations maintaining functional interactions

    • Elucidation of molecular mechanisms underlying cytonuclear incompatibility

  • Speciation Mechanism Insights:

    • Understanding how cytonuclear incompatibilities contribute to reproductive isolation

    • Determining the role of photosynthetic efficiency in adaptive divergence

    • Clarifying the genetic architecture of species boundaries in the Oenothera complex

This research direction not only enhances understanding of a fascinating evolutionary genetic system but also provides broader insights into mechanisms of co-evolution between organellar and nuclear genomes across plants.

How can structural and functional studies of Oenothera glazioviana Apocytochrome f contribute to designing improved photosynthetic efficiency in crop plants?

Structural and functional studies of Oenothera glazioviana Apocytochrome f can make significant contributions to engineering enhanced photosynthetic efficiency in crops through several research pathways:

Fundamental Insights Informing Engineering Approaches:

  • Structure-Function Relationship Mapping:

    • Identify rate-limiting steps in electron transfer processes

    • Characterize structural determinants of binding kinetics with electron donors/acceptors

    • Determine factors affecting stability under varying environmental conditions

    • Define the molecular basis of integration into functional complexes

  • Comparative Performance Analysis:

    • Assess electron transfer efficiency across naturally occurring variants

    • Identify sequence modifications associated with enhanced performance

    • Compare kinetic parameters between Oenothera glazioviana and crop species homologs

Engineering Strategies Based on Apocytochrome f Knowledge:

  • Targeted Protein Engineering:

    • Modify specific residues to alter redox potentials for optimized electron flow

    • Enhance protein stability under high temperature or light conditions

    • Improve interaction dynamics with electron transfer partners

    • Reduce susceptibility to photoinhibition-related damage

  • Synthetic Biology Approaches:

    • Design chimeric proteins incorporating beneficial features from multiple species

    • Express optimized Apocytochrome f variants in crop chloroplasts

    • Engineer coordinated modifications across multiple components of the electron transport chain

    • Implement dynamic regulatory elements responsive to changing light conditions

Experimental Validation Frameworks:

Agricultural Applications:

This research direction holds significant potential for addressing global food security challenges by enhancing the fundamental energy conversion processes that underlie all crop productivity.

What are the most promising future directions for research involving Oenothera glazioviana Apocytochrome f in the context of both basic science and applied biotechnology?

Research involving Oenothera glazioviana Apocytochrome f stands at the intersection of fundamental plant molecular biology and applied biotechnological innovation, with several promising future directions:

Fundamental Science Opportunities:

  • Evolutionary Biology:

    • Deeper investigation of nuclear-chloroplast co-evolution using the unique genetic system of Oenothera glazioviana

    • Analysis of selection pressures on photosynthetic proteins across diverse habitats

    • Elucidation of molecular mechanisms underlying cytonuclear compatibility

  • Structural Biology:

    • High-resolution structural characterization of species-specific features

    • Dynamic structural studies capturing conformational changes during electron transfer

    • Investigation of protein-protein interaction networks within photosynthetic complexes

  • Regulatory Mechanisms:

    • Comprehensive mapping of post-translational modifications and their functional significance

    • Identification of regulatory mechanisms controlling protein turnover and assembly

    • Characterization of stress-responsive modifications affecting electron transport efficiency

Applied Biotechnology Potential:

  • Agricultural Innovations:

    • Development of crops with enhanced photosynthetic efficiency under suboptimal conditions

    • Engineering stress-resistant variants for changing climate scenarios

    • Optimization of electron transport to improve water and nitrogen use efficiency

  • Bioenergy Applications:

    • Creation of optimized electron transport systems for biofuel production

    • Development of artificial photosynthetic systems incorporating engineered cytochrome components

    • Enhancement of electron transfer to alternative acceptors for biotechnological applications

  • Synthetic Biology Platforms:

    • Design of minimal synthetic electron transport chains with enhanced efficiency

    • Creation of novel cytochrome variants with altered spectral properties for sensing applications

    • Development of modular systems allowing rapid adaptation to different environmental conditions

Methodological Advances Supporting Future Research:

  • Technical Innovations:

    • Development of improved expression and purification systems for membrane proteins

    • Advanced imaging techniques for visualizing electron transport in living systems

    • High-throughput screening methods for identifying enhanced performance variants

  • Computational Approaches:

    • Machine learning algorithms predicting functional impacts of sequence variations

    • Molecular dynamics simulations of complete photosynthetic complexes

    • Systems biology models integrating electron transport with carbon fixation pathways

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.