Recombinant Oenothera glazioviana ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Description

Molecular Definition and Production

Recombinant atpI is a 247-amino acid protein (UniProt ID: B0Z547) expressed in E. coli with an N-terminal His-tag for purification . It corresponds to the full-length ATP synthase F0 sector subunit a, which facilitates proton translocation across thylakoid membranes during ATP synthesis . Key production details include:

ParameterSpecification
Expression SystemE. coli
TagHis-tag (N-terminal)
Molecular Weight~27 kDa (theoretical)
Purity>85% (SDS-PAGE verified)
StorageTris buffer with 50% glycerol at -20°C

Mutation Rescue Mechanisms

Transplastomic tobacco lines engineered with atpB frameshifts (+1A) exhibited mottled phenotypes but produced functional AtpB through ribosomal frameshifting, highlighting the role of homopolymeric sequences (e.g., oligoA) in error correction . This mechanism likely extends to atpI, given its structural homology .

Proteomic Interactions

Proteomic profiling of Oenothera glazioviana under copper stress identified ATP synthase subunits (including atpI) as differentially regulated, suggesting their role in stress adaptation . Key findings:

  • Upregulation: ATP synthase subunits increased 1.58-fold under Cu stress .

  • Functional Networks: Coordinated expression with detoxification proteins (e.g., Clp protease) .

Biotechnological Utility

Recombinant atpI is commercially available for:

  • Enzyme Activity Assays: Studying proton translocation kinetics .

  • Protein Interaction Studies: Mapping interfaces with atpF or CF1 subunits .

  • Structural Biology: Cryo-EM or X-ray crystallography to resolve F0 sector architecture .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. To request a specific tag, please indicate this in your order; we will prioritize your request.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Oenothera glazioviana (Large-flowered evening primrose) (Oenothera erythrosepala)
Target Names
atpI
Target Protein Sequence
MDVLSCSNNTLKGLYDISGVEVGQHFYWQIGGFQVHGQVLITSWVVIAILLGSASIAVRN PQTIPNDSQNFFEYILEFIRDVSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKLV ELPHGELAAPTNDINTTVALALLTSVAYFYAGLSKKGLGYFSKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function

Key component of the proton channel; it plays a crucial role in proton translocation across the membrane.

Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of the atpI gene in Oenothera glazioviana plastomes?

The atpI gene in O. glazioviana is located within the chloroplast genome, which ranges from 163,365 bp to 165,728 bp in size depending on the plastome type. Oenothera species are characterized by five genetically distinct plastid chromosomes (I-V) with sequence similarities between 96.3% and 98.6% . The atpI gene is one of 113 unique genes encoded by these plastomes . Unlike many vascular plants, the plastomes of O. glazioviana and other members of subsection Oenothera contain a subsection-specific 56 kb inversion within the large single-copy segment that disrupted operon structures approximately 1 million years ago . This inversion represents a key evolutionary event that predates the divergence of the subsection.

How does the atpI gene differ among Oenothera plastome types?

The atpI gene shows variability among the five plastome types (I-V) in Oenothera. Comparative analyses of these plastomes reveal that diversification is primarily caused by nucleotide substitutions, small insertions, deletions, and repetitions . When analyzing evolutionary rates in Oenothera plastome genes, researchers often calculate Ka (nonsynonymous substitution rate) and Ks (synonymous substitution rate) values. The ratio of Ka/Ks for atpI and other genes provides insights into selective pressures. Studies have shown that a remarkable number of genes in Oenothera plastomes, potentially including atpI, have high Ka/Ks ratios, consistent with an active role in speciation processes .

What techniques are used to isolate and characterize the atpI gene from Oenothera glazioviana?

To isolate and characterize atpI from O. glazioviana, researchers typically follow these methodological steps:

  • DNA Isolation: Total DNA extraction using specialized protocols for plant materials rich in secondary metabolites

  • PCR Amplification: Using conserved primer pairs designed from highly conserved regions in Oenothera plastomes

  • Sequencing: Direct sequencing of PCR products or cloning followed by sequencing

  • Sequence Analysis: Alignment and comparison with known atpI sequences from related species

  • Functional Domain Prediction: In silico analysis of protein structure and functional domains

The PCR amplification approach follows methods similar to those used for verifying inversion breakpoints in Oenothera, where primer pairs derived from conserved regions are used with long-range PCR protocols .

What are the optimal methods for creating recombinant atpI constructs from Oenothera glazioviana?

For recombinant expression of atpI from O. glazioviana, researchers should consider the following methodology:

  • Gene Synthesis or PCR Cloning: The atpI gene can be either synthesized based on the known sequence or amplified using high-fidelity DNA polymerase from O. glazioviana chloroplast DNA

  • Vector Selection: Choose expression vectors compatible with plant chloroplastic proteins, which often contain hydrophobic domains

  • Transformation Strategy: For bacterial expression, low-copy vectors (such as pMW118) are recommended to minimize potential toxicity of the hydrophobic gene products

  • Codon Optimization: Consider codon optimization for the expression system to enhance protein yield

  • Fusion Tags: Include appropriate fusion tags (His-tag, GST, etc.) to facilitate purification while maintaining protein function

Temperature-sensitive replicons (like pG+host4) can be particularly useful when working with potentially toxic membrane proteins like ATP synthase subunits . For functional studies, a PCR product containing the atpI gene and approximately 1-1.5 kb of upstream region should be generated to ensure proper regulatory elements are included .

How can researchers confirm the successful expression of recombinant atpI protein?

Confirmation of successful expression requires multiple validation techniques:

  • Western Blotting: Using antibodies specific to atpI or to fusion tags

  • Mass Spectrometry: For protein identification and post-translational modification analysis

  • Functional Assays: ATP synthesis activity measurements in reconstituted systems

  • Localization Studies: Confirming proper membrane integration using fractionation techniques

  • Circular Dichroism: To verify proper protein folding

For quantitative assessment of expression levels, researchers should establish standard curves using purified standards and apply multiple detection methods to cross-validate results.

What approaches are most effective for studying atpI function in ATP synthase assembly?

To study the role of atpI in ATP synthase assembly, researchers should employ:

  • Deletion Mutants: Creating in-frame deletion mutants (ΔatpI) to assess the impact on ATP synthase assembly and function

  • Site-Directed Mutagenesis: Targeting conserved residues to identify functional domains

  • Protein-Protein Interaction Studies: Co-immunoprecipitation, yeast two-hybrid, or split-GFP assays to identify interaction partners

  • Blue Native PAGE: To analyze intact ATP synthase complexes and subcomplexes

  • Cryo-EM Analysis: For structural determination of the assembled complex

A comparison of wild-type and ΔatpI mutants reveals the contribution of atpI to ATP synthase stability and function. For mutant construction in Oenothera or model organisms, the strategy described by Biswas et al. can be adapted, involving amplification of sequences upstream and downstream of the region to be deleted, followed by recombination .

How does atpI contribute to plastome-genome incompatibility in Oenothera species?

The atpI gene may be involved in plastome-genome incompatibility (PGI) phenomena observed in Oenothera species. To investigate this:

  • Sequence Comparison: Compare atpI sequences across the five plastome types (I-V) to identify variations

  • Association Analysis: Correlate sequence differences with known incompatibility patterns

  • Evolutionary Rate Analysis: Calculate Ka/Ks ratios for atpI to assess selective pressure

  • Transgenic Complementation: Introduce variant atpI genes into incompatible combinations to test for rescue

  • Structural Modeling: Predict how sequence variations affect protein structure and function

Research has shown that plastome-genome compatibility analysis requires four computational approaches: estimation of evolutionary rates for protein-coding regions, analysis of predicted polypeptide variance, RNA editing patterns, and phylogenetic footprinting of polymerase binding sites . For atpI specifically, researchers should focus on nucleotide positions that differ between compatible and incompatible plastome-genome combinations.

How does the atpI gene from Oenothera glazioviana compare with homologs in other plant species?

Comparative analysis of atpI across plant species reveals:

  • Sequence Conservation: The core functional domains of atpI are generally conserved across plant species

  • Species-Specific Adaptations: Variations in non-catalytic regions may reflect adaptations to different environmental conditions

  • Phylogenetic Relationships: atpI sequence data can contribute to understanding evolutionary relationships

  • Structural Implications: Amino acid substitutions can affect interactions with other ATP synthase subunits

What can we learn from comparing atpI function between chloroplasts and bacterial ATP synthases?

The comparison between chloroplastic atpI from O. glazioviana and bacterial homologs provides insights into evolutionary conservation and functional adaptation:

FeatureChloroplastic atpI (O. glazioviana)Bacterial atpI (e.g., Bacillus)
Primary FunctionATP synthesisATP synthesis
Secondary RolesPossibly involved in ion transportMay function as Mg²⁺ or Ca²⁺ transporter
Oligomeric StatePart of multi-subunit complexCan form homo-oligomers
RegulationRegulated by light-dependent processesRegulated by energy demand
Evolutionary OriginDerived from endosymbiotic bacteriaNative bacterial protein

Research approaches for functional comparison include:

  • Complementation studies in bacterial systems

  • Reconstitution experiments with purified proteins

  • Structural analysis of conserved domains

  • Electrophysiological measurements of channel functions

Studies on bacterial ATP synthase suggest that AtpI may function as a Mg²⁺ transporter, Ca²⁺ transporter, or channel protein, potentially as homo-oligomers or hetero-oligomers with other subunits . Similar functions might exist for the chloroplastic atpI in O. glazioviana.

How can atpI be used to study chloroplast evolution and speciation in Oenothera?

The atpI gene serves as a valuable molecular marker for evolutionary studies in Oenothera due to:

  • Phylogenetic Signal: Sequence variations in atpI contribute to understanding relationships among Oenothera plastomes

  • Selective Pressure: Ka/Ks analysis of atpI helps identify evolutionary forces acting on the gene

  • Co-evolution Patterns: Comparing nuclear and plastid gene evolution reveals co-evolutionary dynamics

  • Marker for Hybridization: atpI sequences can track plastome inheritance in hybridization events

Research has shown that phylogenetic relationships based on plastome sequences suggest plastomes I-III form one clade, while plastome IV appears closest to the common ancestor . The atpI gene can be analyzed within this evolutionary framework to understand its specific role in adaptation and speciation.

What methodological considerations are important when using CRISPR/Cas9 to modify the atpI gene?

When applying CRISPR/Cas9 gene editing to modify the chloroplastic atpI gene, researchers should consider:

  • Delivery Method: Chloroplast transformation requires specialized approaches different from nuclear transformation

  • Guide RNA Design: Target unique sequences to avoid off-target effects in nuclear or mitochondrial genomes

  • Homology-Directed Repair Templates: Design with sufficient homology arms (>500 bp) for efficient recombination

  • Selection Markers: Use appropriate markers for chloroplast transformation (spectinomycin resistance is common)

  • Confirmation Methods: Employ PCR, sequencing, and functional assays to verify modifications

Since chloroplasts contain multiple genome copies, achieving homoplasmy (uniform modification of all copies) is essential. This typically requires multiple rounds of selection under increasing selective pressure.

How can researchers overcome challenges in expressing functional recombinant atpI protein?

Membrane proteins like atpI present specific expression challenges. Researchers can address these through:

  • Expression Systems: Test multiple systems (E. coli, yeast, insect cells) to identify optimal conditions

  • Culture Conditions: Optimize temperature, induction timing, and media composition

  • Solubilization Strategies: Select appropriate detergents for membrane protein extraction

  • Fusion Partners: Test various solubility-enhancing fusion tags

  • Co-expression: Consider co-expressing with interaction partners to improve stability

For hydrophobic proteins like atpI, maintaining plasmids in low-copy vectors (e.g., pMW118) during manipulations can minimize potential toxicity . Additionally, growth at lower temperatures (e.g., 30°C instead of 37°C) often improves proper folding of membrane proteins.

What strategies help resolve conflicting experimental results when studying atpI function?

When facing contradictory results in atpI research:

  • Method Validation: Verify all experimental protocols with appropriate controls

  • Multiple Approaches: Apply independent methodologies to address the same question

  • Environmental Variables: Test whether growth conditions affect experimental outcomes

  • Genetic Background: Consider the influence of different genetic backgrounds on atpI function

  • Post-translational Modifications: Investigate whether protein modifications affect function

Researchers should also consider the impact of plastome-genome interactions, which are particularly relevant in Oenothera species where artificially produced plastome-genome combinations that do not occur naturally often display interspecific plastome-genome incompatibility .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.